KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_102225Help
Entry
VOLCADRAFT_102225 CDS       T01330                                 

Definition
hypothetical protein
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vcn00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    VOLCADRAFT_102225
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VOLCADRAFT_102225
Enzymes [BR:vcn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     VOLCADRAFT_102225
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 271 aa AA seqDB search
MSTLFYEPSTRTRLSFESAMSRLGGTVLSTESAGEYSSAAKGETLEDTVRTVEGYADCIV
IRHFQEGSAKRAASVASIPILNAGDGPGQHPTQALLDLYTIQREIGRLESIKVGMIGDLA
NGRTVRSLCMLLSMYNDIQIYFVAPDVVRMRDDVKNYLTARGVRWTEVSDLREVTADADV
LYQTRIQRERFQNPDDYAAARGKYIIDRDLMRILKPTAVVMHPLPRVDEITTDVDSDPRA
AYFRQARNGLYVRMALLKLCLADGYQPDIAL
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgcttttctacgagccttccacacgaacgcgtctgtcgtttgagtccgccatg
agtcggctgggcggcaccgtgctctcaaccgagtccgcgggcgagtactcgtccgcagct
aagggcgagacgctggaagacaccgtgcgtaccgtggagggctacgcggattgcatcgtc
attcgacatttccaggagggcagtgccaagagggccgcctccgtggcttccatacccatc
ctcaatgcgggtgatggccccgggcagcacccgacgcaggccctcttggacctgtacacc
atacagcgggagatcggacgtctggagagcatcaaagtgggcatgattggcgacctggcc
aacggccgtaccgtcaggtcgttgtgcatgttgctgtccatgtacaacgacatacagatt
tactttgtggcgccggatgtcgtccggatgagggatgacgtcaagaactacctcaccgcg
cggggtgtgcggtggacggaggtatccgacctgcgcgaggtgacggcggatgcggatgtc
ctgtaccagacccgtattcagcgggagcgttttcagaacccagacgattacgcagctgct
cgcggcaagtacatcatcgacagggacctgatgcgcattctgaagcccactgcggtggtg
atgcacccgctgccgcgcgtggatgagatcaccacggacgtggacagcgacccgcgggcc
gcctacttccgccaggcgcgtaacggcctgtacgtcaggatggctcttctgaagctgtgc
ttggcggatggttaccagccggatattgctttgtaa

DBGET integrated database retrieval system