KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_102225Help
Entry
VOLCADRAFT_102225 CDS       T01330                                 

Definition
hypothetical protein
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:vcn00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:vcn00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 271 aa AA seqDB search
MSTLFYEPSTRTRLSFESAMSRLGGTVLSTESAGEYSSAAKGETLEDTVRTVEGYADCIV
IRHFQEGSAKRAASVASIPILNAGDGPGQHPTQALLDLYTIQREIGRLESIKVGMIGDLA
NGRTVRSLCMLLSMYNDIQIYFVAPDVVRMRDDVKNYLTARGVRWTEVSDLREVTADADV
LYQTRIQRERFQNPDDYAAARGKYIIDRDLMRILKPTAVVMHPLPRVDEITTDVDSDPRA
AYFRQARNGLYVRMALLKLCLADGYQPDIAL
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacgcttttctacgagccttccacacgaacgcgtctgtcgtttgagtccgccatg
agtcggctgggcggcaccgtgctctcaaccgagtccgcgggcgagtactcgtccgcagct
aagggcgagacgctggaagacaccgtgcgtaccgtggagggctacgcggattgcatcgtc
attcgacatttccaggagggcagtgccaagagggccgcctccgtggcttccatacccatc
ctcaatgcgggtgatggccccgggcagcacccgacgcaggccctcttggacctgtacacc
atacagcgggagatcggacgtctggagagcatcaaagtgggcatgattggcgacctggcc
aacggccgtaccgtcaggtcgttgtgcatgttgctgtccatgtacaacgacatacagatt
tactttgtggcgccggatgtcgtccggatgagggatgacgtcaagaactacctcaccgcg
cggggtgtgcggtggacggaggtatccgacctgcgcgaggtgacggcggatgcggatgtc
ctgtaccagacccgtattcagcgggagcgttttcagaacccagacgattacgcagctgct
cgcggcaagtacatcatcgacagggacctgatgcgcattctgaagcccactgcggtggtg
atgcacccgctgccgcgcgtggatgagatcaccacggacgtggacagcgacccgcgggcc
gcctacttccgccaggcgcgtaacggcctgtacgtcaggatggctcttctgaagctgtgc
ttggcggatggttaccagccggatattgctttgtaa

DBGET integrated database retrieval system