KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_103030Help
Entry
VOLCADRAFT_103030 CDS       T01330                                 

Definition
hypothetical protein
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
vcn  Volvox carteri f. nagariensis
Brite
Enzymes [BR:vcn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     VOLCADRAFT_103030
    1.3.1.94  polyprenol reductase
     VOLCADRAFT_103030
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 382 aa AA seqDB search
MSASLHDVAFLLADSFLNVLPQLLRAYWILASASVFVTILPIPVPRAFKAAVKVAAARGK
LWYDRPDARALGILKDVSVPQQFFEHFYLIGALANTVLLQVYIFVCCEDQNGSTLKRDSL
LALLLFELHVLRRYFESNYVMHYPESARMHLLAYLYGLSYYVAVPLTLLPTAVLNMDALR
SAWDLAVGAGKEHWQLVDKRLWEAVATPHPGLPRLIAGVALFLFASGLQYWSHAVLGRLS
REGGKRVQEAQMADTLFPPRAGNSTGAGPADQRTGTAGGAGAAGVEQVDQNPDGSLAAPK
LTDVYSIPRGGPFELVSCPHYLGEILIYVALALVTRGSVGTLLIAAWVLLNLVLAADATQ
RWYHHHFPDYPRRRAALIPLLF
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcaagcttacacgacgtggcgtttttgcttgcggactcgttcttgaacgtactg
cctcagctacttcgtgcctactggatattggcatcggcctcagtattcgtgactatcctt
cccattcctgttccgcgcgcgttcaaagctgctgttaaagtggctgctgcccgtggcaag
ctatggtatgaccgccccgacgcacgcgcgctgggcatcctcaaggacgtgtcggttcca
cagcaatttttcgagcacttttacctgattggggcattagccaacacggtgctgctccag
gtctacatctttgtgtgctgtgaagaccagaacggcagcactctcaagcgggactccctg
ttggctctgctgctctttgagctgcacgtgctacgacggtacttcgaatcgaattacgtt
atgcactacccggaaagcgcccgcatgcacctgctggcgtacctgtacggcctgtcgtat
tacgtcgccgtaccgctgacgctgcttccgacagccgtcctaaacatggatgccctccgc
agcgcttgggatctggctgttggtgcgggtaaggagcactggcaactggttgacaagcgg
ctgtgggaggccgtggcgacaccccacccgggcctgccccgcctgattgcgggcgtggcg
ttattcctgttcgccagcggcctgcagtactggagccatgccgtactgggtcggctatct
agggagggtggtaagcgcgtgcaggaggcccagatggccgacaccttgttccctccccgc
gccggaaacagcaccggcgccggcccagccgatcagcgcactgggactgcagggggtgca
ggagcggctggtgtagagcaagtggatcagaacccggatggctctctggcggcgcccaag
ctgacggacgtgtacagcatcccgcggggcgggccttttgaactggtgagctgtccccac
tacctaggggagatcctgatctacgtggccctggcgctggtgacccgcgggtcggtgggc
acactgctgattgccgcctgggtgttgctaaacctcgttctcgcggcggacgccacacag
cgctggtaccaccaccatttccccgactacccaaggcgccgtgccgctctcataccactg
ctgttttga

DBGET integrated database retrieval system