KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_103465Help
Entry
VOLCADRAFT_103465 CDS       T01330                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:vcn01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:vcn00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:vcn00750]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 505 aa AA seqDB search
MRTLQQPTLRSGARRGVFTPCSRNMQRILATAAHADIRREAMLRVPLEKAHTFNAKFVPF
TDIQTSNTSSEFYSLDDVVYRSRDGGLLDVHHDMKALSQYGPEYWRALFDARVGTTAWPF
GSGVWSKKEWVLPGLSDDDIVSMFEGNSNLFWAERFGKEALGMTDLWVKQCGNSHTGSFK
DLGMTVLVSQVNRIRKLKPGSITAVGCASTGDTSAALSAYCAAAGIPSIVFLPADKISLA
QLVQPIANGALVLSIDTDFDGCMRLIKQVTAETPIYLANSMNSLRLEGQKTAAIEILQQF
DWQVPDWVIIPGGNLGNIYAFYKGFKMCKELGLVDKMPRLVCAQAQNANPLYQAFHKAQG
VSQIKESYQAVKAKTTFASAIQIGDPVSIDRAIMALQDANGIVEEASEEELMDAAARADR
TGMFNCPHTGVALAALLKLRERQIIGPNDRTVVVSTAHGLKFAQSKVAYHSKSVPNMTCQ
FANPPVQVKEDLGAVMDAIKAKFSL
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaggacacttcagcagccaacccttcgcagcggcgcgcgcaggggtgtgttcacacca
tgcagccgtaatatgcaacgaattctcgccacagctgcgcacgcggatatccgacgggaa
gctatgctccgggtgccgcttgagaaggcgcacacgttcaatgccaaattcgtgcctttc
accgatatccaaactagcaatacgtctagcgaattttacagtctggacgacgtcgtttac
cgatcgcgggacggcggcctgctggatgtgcaccatgatatgaaggcgttgtcgcagtat
ggaccggagtactggcgagccttgtttgatgctcgggttgggacaactgcttggcccttc
ggatccggtgtatggagcaagaaggaatgggtgctgccgggtctgtcggacgatgacatt
gtgtctatgttcgaaggcaacagcaacctattctgggcggaacgttttggcaaggaggcc
ctgggtatgactgacttgtgggtcaagcagtgcggtaacagccatacgggctccttcaag
gatttgggcatgacagtgcttgttagtcaggtgaaccgcattcggaagcttaagccaggc
agcatcacagccgttggctgcgcttccactggcgacacgtcagcggcgctgtctgcctac
tgtgccgccgcgggcattccctcgatcgtcttcctgccagcggacaaaatctcgctggcg
cagctcgtgcaaccaattgctaatggcgcgctggtgcttagcattgacacggactttgac
ggctgcatgcgcctgatcaagcaggtcacggcagagacccccatctacctggcgaacagc
atgaacagcctgcggcttgaggggcaaaagaccgctgcaattgagattttgcaacagttc
gactggcaagtgcccgactgggttattatccccggtggcaacctcggcaatatctatgcc
ttttacaagggcttcaaaatgtgcaaggagctgggtctcgtggacaagatgccgcggctc
gtgtgcgcacaggcacagaacgccaacccgctttaccaggcgttccataaagcgcaaggt
gtttcgcaaattaaggagagctaccaggccgtcaaggcgaagactaccttcgcttcggcc
atccagatcggcgatcctgtgtccatcgaccgagcaatcatggcgctgcaggacgccaac
ggcattgtggaggaggcctcggaggaggagctcatggacgccgcggcgcgtgcggaccgc
accggcatgttcaactgcccccacacgggtgttgcgctcgccgcattactcaagctccgg
gaaaggcagattattgggcctaacgacaggacggtagttgtcagcacagcccatgggctc
aagttcgcgcagtcaaaggtggcctaccactccaaatccgttcccaacatgacgtgtcag
ttcgcgaacccgccggtgcaggttaaggaggacctgggtgcggtgatggacgcgatcaag
gctaagttcagcctctga

DBGET integrated database retrieval system