KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_103826Help
Entry
VOLCADRAFT_103826 CDS       T01330                                 

Definition
(RefSeq) hypothetical protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
vcn00052  Galactose metabolism
vcn00500  Starch and sucrose metabolism
vcn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vcn00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    VOLCADRAFT_103826
   00500 Starch and sucrose metabolism
    VOLCADRAFT_103826
Enzymes [BR:vcn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     VOLCADRAFT_103826
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 9623977
NCBI-ProteinID: XP_002948353
JGI: 103826
UniProt: D8TPG6
Position
Unknown
AA seq 586 aa AA seqDB search
MSPTQPTETAALVRQDRPSFHIAPQQGWMNGDYVQACLSPVTKYSHETVSADLSKSSLVQ
VLPTYSQGLHLAVRPGLGPLCFTRPCQLGASTTRNRMHTWKFRCRWLLQRLRNARRERRS
DYPIYDPKLTYWTKIEYPWLSLPPPSNGLERLAGWRDPAIISRPGDEGSDCWTMIIGSGV
KDSGGSVLVYTSKELLDGWQFHGELCHGRGNGADTGFMWECPILFKLSTLPRNASLFGSG
GQPDACTNPSYYWLGPYDPVSRRFDLATSQGPYRLDLGNVLYAPNILHDTAKGRTLLWGW
GQEQRNKVDVYDYAGCLTLPRVMWLQYCADPSTDSSTDSAVCSLALHQQPLPELAELRHP
LRSWRLQDALPLGVMDLIVDGGAKMPVPTVSGPFLDLELVFQPAADCNADEPRCSASGLL
LQSWSSGPEGSAALIYNWDTGILEVVYEAIDPATLTFSLAAPGVRRVGGRLQRPPAPGSP
LSLRVFLDYSCLEVFTGEGEVLTARVYRGSAPTNPGYPAGSSSGIDFISADGPTRLIHFA
AYEMQPAFQSGISSEDEATASVPLPYESLLEGVERLEMAGAAGGAA
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccaacgcaaccgacggagacagccgccctcgtgcgccaggaccggccctcattc
catattgcaccccaacaaggatggatgaacggtgattacgtgcaggcttgtctctcgcct
gtgacaaagtactcgcacgaaacggtttcagcagatctttcgaaatcatccttggttcag
gttctaccaacatattcccaagggctgcacctggcagttcggcctggtctggggccattg
tgtttcacgcgaccttgtcaactgggagcatctaccacccgcaatcgaatgcacacctgg
aagtttagatgccgatggctgcttcagcggctgcgcaacgctagacgagaacggcgttcc
gactatcctatatacgaccccaagctgacgtactggacgaagattgagtacccttggctg
tcactgccaccgccgtccaacggactggagcgcctcgctggctggcgtgaccctgccatc
atcagccgaccgggggatgagggctccgactgctggactatgattattggcagcggtgtc
aaggacagtggcggcagcgttctcgtgtacacctcgaaagagctactggatggatggcaa
tttcacggcgagctttgccacggtcgtgggaacggcgcagacacgggcttcatgtgggag
tgtccgatcctttttaagctttcaactctcccgcgcaacgcgtcgctttttggaagcgga
ggacagcctgatgcatgtacaaatccatcatactactggctggggccgtatgaccccgtc
tcgaggcgcttcgacctggcaacctcgcaaggcccttaccgcctggaccttggaaacgtc
ctgtatgcgcccaatattctccacgacactgccaagggccggacgcttctgtggggttgg
ggccaagagcagcggaacaaggtggacgtgtacgactacgcggggtgcttaactcttccg
cgagtcatgtggctccagtactgtgcagatccctccactgactcgtctacggattctgcg
gtctgctctttggcgcttcatcagcagcctttgccagagctggcggagctgcgccacccg
cttcgctcctggcgcttgcaagatgcgctgcccttgggggtcatggatctaatcgttgac
ggcggggcgaagatgccggtgccaaccgtatcgggtcccttcctggacttggagctggtt
ttccagcccgcggccgactgcaacgccgacgagccacgttgctcagcgtcggggctcctg
ctgcagagctggagcagcggccctgagggctcagcagcgctaatttacaattgggacacc
ggcattcttgaggtcgtttacgaggcaatcgacccggctacgcttaccttcagcttggcg
gccccaggggtgcggcgagtcggcggccggctgcagcggccgcctgccccgggcagcccg
ttgtcacttcgcgtgttcctggactactcctgcctcgaggtgttcacgggagaaggcgag
gtgctcacggcgcgagtctaccgcggcagtgcgcccaccaaccctgggtatcccgcgggt
tctagctcgggtattgacttcatatccgctgacggtcccacacggctcatccactttgcg
gcgtatgagatgcagcccgccttccagtcaggcatcagcagcgaagatgaggcaacggcg
tctgtgccgttgccatacgagtcgcttctggagggtgtagagcggttggagatggctggc
gccgctggtggtgcagcttaa

DBGET integrated database retrieval system