KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_104811Help
Entry
VOLCADRAFT_104811 CDS       T01330                                 

Gene name
chc1
Definition
vesicle coat protein clathrin, heavy chain
Orthology
K04646  
clathrin heavy chain
Organism
vcn  Volvox carteri f. nagariensis
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:vcn04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 1716 aa AA seqDB search
MAQAAPLLVQEKLSLPSIGVAQDFISFKNVTMESDKYICIRETGAQNTVVIVDMSNPLSP
ARRQISADSALMCLDKKVIALKAVTAGQAGDTLQVFNLDTKTKLKAYQMPETVEFWKWIS
PTMLGLVTSAAVYHWDVEGSSDAPVKVFERIPNLAGAQIISYRTSPDGKWAVLVGIAPGA
PERPQLAKGLMQLYSFEQAKSQPLEAHAAAFANVKFTGRDAPSLVISFAQKTLKDGQILS
KLHVIELGGGAAGGPIKRSAELFFPADFADDFPVSLQIGEKYGLVYVVSKLGFVFVYDLE
SATAVYRNRISTDPVFLACTSDVTGGIFCVNRRGQVLLVTVNEGAMVPFVSQQLNNLDLA
MAMAKRGNLPGAEALVGQQFERYFAAGQYKEAAECAAESPQGQLRTKEVMDRLKSAVPPP
GQKPPILVYLGVLLQRGRLNGPESGELARLVLSQNKKELLVNWWGEGKLEACEELGDAIS
AAGDKDFALKVYQQCGAGQKVIATLAEKGDIQALIAYTNATGQKLDYMFLLQSLMMNNPN
GAVALAKMIAKQMPPPVDVNVMADLFLQRNMVREATAFLLEALSGDRPEQGPLQTKLLEV
NLITNPQVADAILAGGTLSHYDRPRIAQLCEKAGLYMRALQHYTDLSDIKRCIINTHAID
PQALVEFFGTLSSEWALECLKELLVSNMTQNLQLVVNIAKEYTEQLTPSKIIELFEAYNS
YHGLYFYLGSRIAFTENSEEHFKYIEAAARTGNLKEVERVTRESSFYPPDKVKAFLMEAK
LPDARPLINVCDRFDLVEDLTQYLFANNMLRYIEGYVQKVNPSKTPAVVGALLDCEAPDE
FINNLILSVRSLLPVDGLVEAVERRNRLKLLTPFLEHLISEGSQDPHVHNALGKIIIDTN
NNPEHFLTTNPFYDSLVVGKYAEKRDPNLAVIAYKRGTCDDALIECTSKNALFKPQARYI
VERADPALWAKVLDESNPHRASLVEQVVGTALPESRNPEQVSVTVKAFMAQGLQAELIEL
LEKIVLQNSAFSNNANLQNLLILTAIKSEKSRVKGYIYRLDNFDGPAVAEKAIEHGLAEE
AFEIYKKFNKRVEAIKVIIDQIKDISRASEWAAKCDEAPVWSELAHAQLAAGMVSEAIAS
YLKANDSTKYVAVTEAAKSAGCFDDLVKYLLMVRKKVKEAKVDTELVYAYAKTNNMAALE
EFISSTHQANLQACGDRCYDEGLFEAARVLFAHLPNYGRLASTLVRLRQFQQAVEAARKA
NSPKTWKEVCYACVDEKEFRLAQLCGLAIIVNADELDEVSEYYQRKGHFDDLIALMESGI
GLERAHMGIFTELGILYARYRPEKLMEHLKLFGNRLNIPRLIRVCDEQQHWKELTLLYIS
YDEYDNAALCMINHSPAAWEHVQFKDVAVKVSSTETHYRGLAFYLDEHPDLLCDLLGVLQ
SRLDHGRVVDMMRRANQLPLIKDYLLGVQKANHAEVNEAINGLLIEEEDFEGLKHSISTY
DNFDQLGLATRLEKHELIEFRRLAAMVYKQNGKWRRAVELAKADGLFRDAMETTAQSGEG
ELADELLRYFIDKGEKECFAACLYTCYDLLRPDVVLELSWINGLTDYSMPYMIQMLKEYV
GKVDLLMSERKEQQKEKEEAQQAQRHQEAQRNAYATLMPLALPAPNMVGPGGPGGGYGDP
HGAAAGPTGGFGAPHAPFGTPPHMGGGFGGPAYGQY
NT seq 5151 nt NT seq  +upstreamnt  +downstreamnt
atggcacaggctgcgcccctcttggtgcaggagaagctctcacttccaagcatcggggtg
gcacaagacttcatttcgttcaagaatgtgacgatggagtccgataagtacatctgcatc
cgtgagacaggagcgcagaataccgttgttattgtggatatgtccaacccgttgtcaccg
gcaagacggcaaatcagtgcggacagtgcgctcatgtgtttggacaagaaggtcatagcg
ctaaaggcagtaacagcggggcaggcaggtgacacacttcaggtctttaatctagacact
aagacgaagttgaaggcctaccaaatgccggagactgtggagttttggaaatggatcagc
ccgacaatgctcggcctggtaacatctgccgctgtttaccactgggacgttgaggggtca
tcagacgctcctgtaaaggtgttcgagcgcatcccgaacttggcgggtgcacagattatc
agctaccggactagcccagacggcaagtgggctgtgctcgttggcatagcacctggcgcc
cccgagaggccgcagctggcgaaggggctgatgcagctgtactccttcgagcaggcaaaa
agccagccgctggaggcacacgcagctgcctttgcgaacgtcaagtttaccgggcgcgat
gcacccagcctggtcatttcgtttgcacagaaaacgctgaaggacgggcagatcctgtct
aagctacacgtgattgagctggggggaggtgcggccgggggccccatcaagcgcagcgcg
gagctattcttccccgcagattttgcagatgacttccctgtgtcgcttcagatcggcgag
aagtacggtttggtctatgtggtctcaaagctcggctttgtgtttgtgtacgatctggag
tcggcgacagctgtgtaccggaatcgtatcagcacagatcccgtcttcttggcttgcaca
agcgacgtgacgggtggtatcttctgcgtcaacaggcgcggccaggtcctgctggtgacg
gttaacgagggcgctatggtgccgttcgttagccagcagctgaacaatctggacctggcc
atggccatggcaaagcgcggaaacttgcctggggcggaggcactggtgggccagcagttt
gagcggtacttcgctgcagggcaatacaaggaagcagcagagtgtgctgcggaatcgccc
cagggccagctccgcactaaggaggtgatggaccgcctgaagtctgctgtgccacctcca
ggccaaaagccccccatcctggtgtatctaggcgtgctgctgcagcgtggcaggctaaac
ggaccggagagcggcgagctagcgaggcttgtgctcagtcagaacaagaaggaactgctg
gtcaactggtggggcgagggcaagctcgaggcatgcgaggagttgggcgacgctatcagc
gcagccggcgataaggacttcgcgctgaaggtttaccagcagtgcggcgctggacagaag
gtgatcgcgacgctggctgagaagggcgacatccaggccctgattgcgtacacaaacgcg
acggggcagaagctggactacatgttcctgctccagagcctcatgatgaacaacccgaac
ggggccgttgccctagctaagatgatcgcaaagcagatgccgccgcctgtggacgtcaac
gttatggcggacttgttcctgcagcgcaacatggttcgcgaggccacagccttcctgttg
gaagctctttcaggggaccgcccggagcagggccctctgcagaccaagctgctggaggtt
aacctcatcacgaacccacaggtggcggacgccattttggcaggcgggacgcttagccac
tacgaccggccccggattgctcagctgtgcgagaaggcaggcctgtacatgcgcgcgctg
cagcattatacagacctgtcggatattaagcgctgcatcatcaacacacatgccatcgat
ccacaggcactggtggaattctttggtaccttgagtagcgagtgggcgctggagtgcctc
aaggagctgttagtgagcaacatgacgcagaacctgcagctggtggtcaacatcgctaag
gagtacacagagcagctcaccccaagcaagatcatcgagctgtttgaggcgtacaactcg
taccacggcctgtacttctatctggggtcacgcatcgcatttaccgagaactcggaagag
cacttcaagtacattgaggcggctgcgcggacgggcaatctgaaggaggtggagcgggta
acccgcgagtcttccttttacccgccggataaggttaaggctttcctcatggaggcgaag
ctgccggatgcccggccactcatcaacgtgtgcgaccgtttcgacctggtggaggacctc
acgcagtacctgtttgcaaacaacatgctccgctacattgagggctacgtccagaaagtg
aaccccagtaagacgccggctgtggtgggcgcgctgctagactgcgaggcgcccgacgag
ttcatcaacaacctgattttgtcagtgcgctcgctgctgcctgtggatgggctggtggaa
gccgtagagcgccgcaaccgcctgaagctgctgacacctttcttggagcacctcattagc
gaggggagccaggacccacacgtgcacaatgcgcttggcaagattatcatcgatacgaac
aacaacccggagcacttcctcaccaccaacccgttctacgactcgctggtggtgggcaag
tacgctgagaagcgcgaccccaaccttgcagttattgcttacaagcgcggcacctgcgac
gacgcgctcatcgagtgcacttcaaagaatgcgctctttaagccacaggccaggtacatc
gtggagcgggcggacccggctttgtgggccaaggtgctcgatgagtccaacccgcaccgt
gcttcgctggttgaacaggtggtgggcaccgctcttccagagagccgaaacccggaacag
gtcagcgtcaccgtcaaggcgttcatggcacaaggcctccaggcggagctcatcgagctt
cttgagaaaattgtgctacagaacagcgccttctctaacaatgcaaacctgcagaacctg
ctcatcctcaccgccattaaatccgagaagtcgcgtgtcaagggctacatctaccgcttg
gacaacttcgatggccccgccgtggcggagaaagccattgagcacgggctggcggaggag
gcgttcgagatttacaagaagttcaacaagcgtgtggaggccatcaaggtcatcatcgat
caaattaaggatattagccgcgcatcggagtgggccgctaagtgcgatgaggcgcctgtt
tggagcgagctggcgcatgcgcagctggcggcgggtatggtttccgaggcgattgcatcg
tacctcaaagccaacgactccaccaagtacgtggctgtaaccgaggccgccaagtcggcc
ggctgctttgacgacctagtcaagtacctgctcatggtccgcaagaaggtcaaggaggca
aaggtggacacagagctcgtgtacgcgtacgctaagaccaacaacatggcggcgctggag
gagttcatttcttctacacaccaggcaaacttgcaggcttgcggtgaccggtgctacgac
gaaggccttttcgaggcggcgcgtgtgctgtttgcccacctgcctaactacggccgtctg
gcttccactctcgtgcggctgcggcagttccagcaggcggtggaagcggcgcggaaggcg
aatagcccgaagacctggaaggaggtctgctacgcttgcgtggacgagaaggagttccgc
ttggcgcagctttgcggtctggccataattgtcaatgcggacgagctggacgaggtatcc
gagtactaccagcgcaagggccacttcgatgatctcatcgccctcatggagagtggcatt
gggcttgaacgtgcacacatgggcatctttacggagcttggcattctgtacgcgcggtac
aggcctgagaagctgatggagcatctgaagctgttcgggaaccggctcaacattccaagg
ctcatccgtgtctgcgacgagcagcagcattggaaggagctcacgctactctacatttca
tacgatgaatacgacaatgcggcactctgcatgattaaccactcgccagcggcttgggag
cacgtgcaattcaaggatgtcgcggtcaaggtgtcgtccacggaaacgcattatcgtggt
ctggcgttttacctggacgagcaccccgacctgctgtgcgacctgctgggcgtgctgcag
tcgcgcctggaccacggtcgtgtggtggatatgatgcgccgtgccaatcagctgcctctc
atcaaagactacctgctgggcgtacagaaagccaaccacgctgaggttaacgaggccatc
aacgggctgcttattgaagaggaggacttcgaggggctcaagcactccatttcgacgtac
gacaacttcgaccagttgggtcttgcgactcgcctcgaaaagcacgagctcatcgagttc
aggcggttggcagctatggtgtacaagcaaaacggcaagtggcgacgcgctgtcgagctg
gccaaggcggatggtcttttccgggatgcaatggagaccacggcacagagtggcgaaggc
gagcttgctgacgagctgcttcgatacttcattgacaaaggggagaaggagtgcttcgcg
gcgtgcctgtacacgtgctacgacctgctgcggcccgatgtcgtgctggagctatcgtgg
attaatggactcactgactactcgatgccgtacatgattcagatgctcaaggagtacgtt
ggcaaggtggatctcctcatgagcgagcgcaaagagcagcagaaagaaaaggaggaggcg
cagcaggcgcaacgccaccaggaggcccagcgaaatgcgtatgcaacgctcatgccgctg
gccttgccagcccccaacatggtcggtccgggcgggccaggcgggggctacggcgatcct
cacggcgcggcagcgggacccaccgggggcttcggtgcaccgcatgcgccgtttgggacg
cccccgcatatgggaggtggttttgggggccctgcatacgggcaatactaa

DBGET integrated database retrieval system