KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_104811Help
Entry
VOLCADRAFT_104811 CDS       T01330                                 

Gene name
chc1
Definition
(RefSeq) vesicle coat protein clathrin, heavy chain
  KO
K04646  
clathrin heavy chain
Organism
vcn  Volvox carteri f. nagariensis
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:vcn00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    VOLCADRAFT_104811 (chc1)
Exosome [BR:vcn04147]
 Exosomal proteins
  Proteins found in most exosomes
   VOLCADRAFT_104811 (chc1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 1716 aa AA seqDB search
MAQAAPLLVQEKLSLPSIGVAQDFISFKNVTMESDKYICIRETGAQNTVVIVDMSNPLSP
ARRQISADSALMCLDKKVIALKAVTAGQAGDTLQVFNLDTKTKLKAYQMPETVEFWKWIS
PTMLGLVTSAAVYHWDVEGSSDAPVKVFERIPNLAGAQIISYRTSPDGKWAVLVGIAPGA
PERPQLAKGLMQLYSFEQAKSQPLEAHAAAFANVKFTGRDAPSLVISFAQKTLKDGQILS
KLHVIELGGGAAGGPIKRSAELFFPADFADDFPVSLQIGEKYGLVYVVSKLGFVFVYDLE
SATAVYRNRISTDPVFLACTSDVTGGIFCVNRRGQVLLVTVNEGAMVPFVSQQLNNLDLA
MAMAKRGNLPGAEALVGQQFERYFAAGQYKEAAECAAESPQGQLRTKEVMDRLKSAVPPP
GQKPPILVYLGVLLQRGRLNGPESGELARLVLSQNKKELLVNWWGEGKLEACEELGDAIS
AAGDKDFALKVYQQCGAGQKVIATLAEKGDIQALIAYTNATGQKLDYMFLLQSLMMNNPN
GAVALAKMIAKQMPPPVDVNVMADLFLQRNMVREATAFLLEALSGDRPEQGPLQTKLLEV
NLITNPQVADAILAGGTLSHYDRPRIAQLCEKAGLYMRALQHYTDLSDIKRCIINTHAID
PQALVEFFGTLSSEWALECLKELLVSNMTQNLQLVVNIAKEYTEQLTPSKIIELFEAYNS
YHGLYFYLGSRIAFTENSEEHFKYIEAAARTGNLKEVERVTRESSFYPPDKVKAFLMEAK
LPDARPLINVCDRFDLVEDLTQYLFANNMLRYIEGYVQKVNPSKTPAVVGALLDCEAPDE
FINNLILSVRSLLPVDGLVEAVERRNRLKLLTPFLEHLISEGSQDPHVHNALGKIIIDTN
NNPEHFLTTNPFYDSLVVGKYAEKRDPNLAVIAYKRGTCDDALIECTSKNALFKPQARYI
VERADPALWAKVLDESNPHRASLVEQVVGTALPESRNPEQVSVTVKAFMAQGLQAELIEL
LEKIVLQNSAFSNNANLQNLLILTAIKSEKSRVKGYIYRLDNFDGPAVAEKAIEHGLAEE
AFEIYKKFNKRVEAIKVIIDQIKDISRASEWAAKCDEAPVWSELAHAQLAAGMVSEAIAS
YLKANDSTKYVAVTEAAKSAGCFDDLVKYLLMVRKKVKEAKVDTELVYAYAKTNNMAALE
EFISSTHQANLQACGDRCYDEGLFEAARVLFAHLPNYGRLASTLVRLRQFQQAVEAARKA
NSPKTWKEVCYACVDEKEFRLAQLCGLAIIVNADELDEVSEYYQRKGHFDDLIALMESGI
GLERAHMGIFTELGILYARYRPEKLMEHLKLFGNRLNIPRLIRVCDEQQHWKELTLLYIS
YDEYDNAALCMINHSPAAWEHVQFKDVAVKVSSTETHYRGLAFYLDEHPDLLCDLLGVLQ
SRLDHGRVVDMMRRANQLPLIKDYLLGVQKANHAEVNEAINGLLIEEEDFEGLKHSISTY
DNFDQLGLATRLEKHELIEFRRLAAMVYKQNGKWRRAVELAKADGLFRDAMETTAQSGEG
ELADELLRYFIDKGEKECFAACLYTCYDLLRPDVVLELSWINGLTDYSMPYMIQMLKEYV
GKVDLLMSERKEQQKEKEEAQQAQRHQEAQRNAYATLMPLALPAPNMVGPGGPGGGYGDP
HGAAAGPTGGFGAPHAPFGTPPHMGGGFGGPAYGQY
NT seq 5151 nt NT seq  +upstreamnt  +downstreamnt
atggcacaggctgcgcccctcttggtgcaggagaagctctcacttccaagcatcggggtg
gcacaagacttcatttcgttcaagaatgtgacgatggagtccgataagtacatctgcatc
cgtgagacaggagcgcagaataccgttgttattgtggatatgtccaacccgttgtcaccg
gcaagacggcaaatcagtgcggacagtgcgctcatgtgtttggacaagaaggtcatagcg
ctaaaggcagtaacagcggggcaggcaggtgacacacttcaggtctttaatctagacact
aagacgaagttgaaggcctaccaaatgccggagactgtggagttttggaaatggatcagc
ccgacaatgctcggcctggtaacatctgccgctgtttaccactgggacgttgaggggtca
tcagacgctcctgtaaaggtgttcgagcgcatcccgaacttggcgggtgcacagattatc
agctaccggactagcccagacggcaagtgggctgtgctcgttggcatagcacctggcgcc
cccgagaggccgcagctggcgaaggggctgatgcagctgtactccttcgagcaggcaaaa
agccagccgctggaggcacacgcagctgcctttgcgaacgtcaagtttaccgggcgcgat
gcacccagcctggtcatttcgtttgcacagaaaacgctgaaggacgggcagatcctgtct
aagctacacgtgattgagctggggggaggtgcggccgggggccccatcaagcgcagcgcg
gagctattcttccccgcagattttgcagatgacttccctgtgtcgcttcagatcggcgag
aagtacggtttggtctatgtggtctcaaagctcggctttgtgtttgtgtacgatctggag
tcggcgacagctgtgtaccggaatcgtatcagcacagatcccgtcttcttggcttgcaca
agcgacgtgacgggtggtatcttctgcgtcaacaggcgcggccaggtcctgctggtgacg
gttaacgagggcgctatggtgccgttcgttagccagcagctgaacaatctggacctggcc
atggccatggcaaagcgcggaaacttgcctggggcggaggcactggtgggccagcagttt
gagcggtacttcgctgcagggcaatacaaggaagcagcagagtgtgctgcggaatcgccc
cagggccagctccgcactaaggaggtgatggaccgcctgaagtctgctgtgccacctcca
ggccaaaagccccccatcctggtgtatctaggcgtgctgctgcagcgtggcaggctaaac
ggaccggagagcggcgagctagcgaggcttgtgctcagtcagaacaagaaggaactgctg
gtcaactggtggggcgagggcaagctcgaggcatgcgaggagttgggcgacgctatcagc
gcagccggcgataaggacttcgcgctgaaggtttaccagcagtgcggcgctggacagaag
gtgatcgcgacgctggctgagaagggcgacatccaggccctgattgcgtacacaaacgcg
acggggcagaagctggactacatgttcctgctccagagcctcatgatgaacaacccgaac
ggggccgttgccctagctaagatgatcgcaaagcagatgccgccgcctgtggacgtcaac
gttatggcggacttgttcctgcagcgcaacatggttcgcgaggccacagccttcctgttg
gaagctctttcaggggaccgcccggagcagggccctctgcagaccaagctgctggaggtt
aacctcatcacgaacccacaggtggcggacgccattttggcaggcgggacgcttagccac
tacgaccggccccggattgctcagctgtgcgagaaggcaggcctgtacatgcgcgcgctg
cagcattatacagacctgtcggatattaagcgctgcatcatcaacacacatgccatcgat
ccacaggcactggtggaattctttggtaccttgagtagcgagtgggcgctggagtgcctc
aaggagctgttagtgagcaacatgacgcagaacctgcagctggtggtcaacatcgctaag
gagtacacagagcagctcaccccaagcaagatcatcgagctgtttgaggcgtacaactcg
taccacggcctgtacttctatctggggtcacgcatcgcatttaccgagaactcggaagag
cacttcaagtacattgaggcggctgcgcggacgggcaatctgaaggaggtggagcgggta
acccgcgagtcttccttttacccgccggataaggttaaggctttcctcatggaggcgaag
ctgccggatgcccggccactcatcaacgtgtgcgaccgtttcgacctggtggaggacctc
acgcagtacctgtttgcaaacaacatgctccgctacattgagggctacgtccagaaagtg
aaccccagtaagacgccggctgtggtgggcgcgctgctagactgcgaggcgcccgacgag
ttcatcaacaacctgattttgtcagtgcgctcgctgctgcctgtggatgggctggtggaa
gccgtagagcgccgcaaccgcctgaagctgctgacacctttcttggagcacctcattagc
gaggggagccaggacccacacgtgcacaatgcgcttggcaagattatcatcgatacgaac
aacaacccggagcacttcctcaccaccaacccgttctacgactcgctggtggtgggcaag
tacgctgagaagcgcgaccccaaccttgcagttattgcttacaagcgcggcacctgcgac
gacgcgctcatcgagtgcacttcaaagaatgcgctctttaagccacaggccaggtacatc
gtggagcgggcggacccggctttgtgggccaaggtgctcgatgagtccaacccgcaccgt
gcttcgctggttgaacaggtggtgggcaccgctcttccagagagccgaaacccggaacag
gtcagcgtcaccgtcaaggcgttcatggcacaaggcctccaggcggagctcatcgagctt
cttgagaaaattgtgctacagaacagcgccttctctaacaatgcaaacctgcagaacctg
ctcatcctcaccgccattaaatccgagaagtcgcgtgtcaagggctacatctaccgcttg
gacaacttcgatggccccgccgtggcggagaaagccattgagcacgggctggcggaggag
gcgttcgagatttacaagaagttcaacaagcgtgtggaggccatcaaggtcatcatcgat
caaattaaggatattagccgcgcatcggagtgggccgctaagtgcgatgaggcgcctgtt
tggagcgagctggcgcatgcgcagctggcggcgggtatggtttccgaggcgattgcatcg
tacctcaaagccaacgactccaccaagtacgtggctgtaaccgaggccgccaagtcggcc
ggctgctttgacgacctagtcaagtacctgctcatggtccgcaagaaggtcaaggaggca
aaggtggacacagagctcgtgtacgcgtacgctaagaccaacaacatggcggcgctggag
gagttcatttcttctacacaccaggcaaacttgcaggcttgcggtgaccggtgctacgac
gaaggccttttcgaggcggcgcgtgtgctgtttgcccacctgcctaactacggccgtctg
gcttccactctcgtgcggctgcggcagttccagcaggcggtggaagcggcgcggaaggcg
aatagcccgaagacctggaaggaggtctgctacgcttgcgtggacgagaaggagttccgc
ttggcgcagctttgcggtctggccataattgtcaatgcggacgagctggacgaggtatcc
gagtactaccagcgcaagggccacttcgatgatctcatcgccctcatggagagtggcatt
gggcttgaacgtgcacacatgggcatctttacggagcttggcattctgtacgcgcggtac
aggcctgagaagctgatggagcatctgaagctgttcgggaaccggctcaacattccaagg
ctcatccgtgtctgcgacgagcagcagcattggaaggagctcacgctactctacatttca
tacgatgaatacgacaatgcggcactctgcatgattaaccactcgccagcggcttgggag
cacgtgcaattcaaggatgtcgcggtcaaggtgtcgtccacggaaacgcattatcgtggt
ctggcgttttacctggacgagcaccccgacctgctgtgcgacctgctgggcgtgctgcag
tcgcgcctggaccacggtcgtgtggtggatatgatgcgccgtgccaatcagctgcctctc
atcaaagactacctgctgggcgtacagaaagccaaccacgctgaggttaacgaggccatc
aacgggctgcttattgaagaggaggacttcgaggggctcaagcactccatttcgacgtac
gacaacttcgaccagttgggtcttgcgactcgcctcgaaaagcacgagctcatcgagttc
aggcggttggcagctatggtgtacaagcaaaacggcaagtggcgacgcgctgtcgagctg
gccaaggcggatggtcttttccgggatgcaatggagaccacggcacagagtggcgaaggc
gagcttgctgacgagctgcttcgatacttcattgacaaaggggagaaggagtgcttcgcg
gcgtgcctgtacacgtgctacgacctgctgcggcccgatgtcgtgctggagctatcgtgg
attaatggactcactgactactcgatgccgtacatgattcagatgctcaaggagtacgtt
ggcaaggtggatctcctcatgagcgagcgcaaagagcagcagaaagaaaaggaggaggcg
cagcaggcgcaacgccaccaggaggcccagcgaaatgcgtatgcaacgctcatgccgctg
gccttgccagcccccaacatggtcggtccgggcgggccaggcgggggctacggcgatcct
cacggcgcggcagcgggacccaccgggggcttcggtgcaccgcatgcgccgtttgggacg
cccccgcatatgggaggtggttttgggggccctgcatacgggcaatactaa

DBGET integrated database retrieval system