KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_105295Help
Entry
VOLCADRAFT_105295 CDS       T01330                                 

Definition
(RefSeq) hypothetical protein
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
vcn00040  Pentose and glucuronate interconversions
vcn00052  Galactose metabolism
vcn00500  Starch and sucrose metabolism
vcn00520  Amino sugar and nucleotide sugar metabolism
vcn01100  Metabolic pathways
Module
vcn_M00361  Nucleotide sugar biosynthesis, eukaryotes
vcn_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:vcn00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    VOLCADRAFT_105295
   00052 Galactose metabolism
    VOLCADRAFT_105295
   00500 Starch and sucrose metabolism
    VOLCADRAFT_105295
   00520 Amino sugar and nucleotide sugar metabolism
    VOLCADRAFT_105295
Enzymes [BR:vcn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     VOLCADRAFT_105295
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGP
Motif
Other DBs
NCBI-GeneID: 9617194
NCBI-ProteinID: XP_002951881
JGI: 105295
UniProt: D8TZU9
Position
Unknown
AA seq 479 aa AA seqDB search
MANHFEEFKAKMEAAGLSAAAIAAFKKNYDQLVAGVTGMVPEDEIDSATGLPSLLDLPSV
SPSEAKTLLSQTAVLKLNGGLGTSMGLEKAKSLLVVKDGKTFLDLIAEQVKHMRKSYGSD
VIFTLMNSFSTSADTRAFLSEKHPDLLLEPFIELMQNMSPKVDAATNKPATYPPHPDNEW
CPPGHGDIYPSLLGSGMLDKLIDKGIKYLFVSNSDNLGATLDLDLLNYFATSKNAFLMEV
CERTAADKKGGHLCVRRTDGRLMLRESAMCPDADKKSFEDIAKHRYFNTNNLWVSLEQLK
ATLERSGGALDLPLIKNKKTVNPRDGKSAAVFQLETAMGSAIECFDSAGAIVVPRSRFAP
VKTCSDLFVLRSDAYVIAEDATVAVAPSLLQSGGAVPLVKLDDAYYKLVDQLEALASDVP
SLIAAKSVTVKGPVKFSPGIVLSGDVSLEAEGGSPSPALLPPGEYSGDVKVGLSAVAPA
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaccacttcgaagagttcaaggccaagatggaggcagcgggcctcagcgcggct
gccattgcggcctttaaaaagaattatgaccaactggtggccggtgtgacaggcatggtg
cctgaagatgagattgacagcgctaccggtctgccctcactgctcgaccttccaagcgtg
tcaccttcggaggccaagactttgctgtcccagactgccgtactgaagctgaatggcggt
ttgggcaccagcatgggcctggagaaggccaagtcgctgctggtggtgaaggacggaaag
acctttctggacctcatcgccgagcaggtcaagcacatgcgcaagtcgtacggctctgac
gtcatcttcaccctcatgaacagcttctccaccagcgccgacacgcgagccttcctgagc
gagaaacacccggacctgctgctggagccgtttatcgagctgatgcagaacatgtccccc
aaggtggatgccgccaccaacaaacccgccacctaccccccacatcccgacaatgagtgg
tgcccccctggccacggcgacatctacccctccctacttgggtccggcatgttggacaaa
ctgatcgacaagggcatcaagtacctgttcgtttccaactccgacaaccttggagccact
ttggatctggatctcctcaactacttcgccacgtccaaaaacgcctttctgatggaggtc
tgtgagcgcaccgccgccgacaagaagggcggtcacctatgtgtccgccgtacagatggc
aggttgatgctgcgggagagcgccatgtgcccggacgcggacaagaagtcctttgaagac
attgcgaaacataggtatttcaacaccaacaacttgtgggtatccctggagcagctgaag
gccaccctggagcggtccggaggggctctggacctgccgctcatcaagaacaagaagacg
gtcaacccgcgggacgggaagtcggccgccgtgttccagttggagacggccatggggtcc
gccatcgagtgcttcgatagcgcaggtgccatcgtggttccccgctctcgtttcgctccc
gtcaagacctgctcggacttgttcgtactgcgctcggacgcgtacgtcatcgcggaagac
gcaaccgtggctgttgcgccctccctgctgcagtcggggggtgccgtaccactcgttaaa
ttggacgatgcgtactacaagttggtagatcaactagaggcgctggcttccgacgtgccc
agcctcatcgcggccaagtccgtaaccgtcaaaggccccgtcaagttctcgccgggtatc
gtcctgagcggcgatgtgagtctggaggctgagggcggctccccctcccccgcgctgcta
ccgcccggggagtactcgggagacgtcaaggtcggactcagcgcagtggcacccgcctag

DBGET integrated database retrieval system