KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_105867Help
Entry
VOLCADRAFT_105867 CDS       T01330                                 

Definition
hypothetical protein
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:vcn04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 452 aa AA seqDB search
MAMPRFVAAVAVLGLLIVNANAFYSPNGPVVELTASNLKSKVKSAGIVLTEFYAPWCGHC
QSLKPAWEQAAKALKGIVAVGAVDCDTHKEVAGEYRIQGFPTIKLLYVDDATGSIKSLDY
NGGRTAKDLVTFALDKAKSLAMKRLGEKASSGSGSSSGSSSGSGSGSDGFYGGTDVVTLT
SDNFRTQVVKSNDLWLVEMYAPWCGHCKALKPAWIEAASELAGKVKIGAVDCTAHQTVCS
EYGVQGYPTIKFFGADKRSPQDYQGGRDSGSIVSFAMAKFAEQVPPPEPVELTSQSVFES
ECLGDSSGAKARRLCLVAFLPDLLDSKAAGRNRYINILKKTAEAYKDKPYSYLWVQGAVQ
EGLESNFGVGGFGYPALVAFNPADKKYTVCKSAFELNHVKDWIEAMRMGGTGALPLQGSL
ASIKSITPWDGQDAKEEAADEFDLSDILNEEL
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggctatgcctagatttgtggccgctgtcgcggtgctaggcttgttgatcgtgaacgcg
aacgccttctactctccgaacgggccggttgtggagctcacggccagcaatttgaagtcc
aaggtcaagagtgctggcatcgtgcttacggagttttacgcgccatggtgtggacactgc
cagtccctgaagccagcttgggagcaggccgccaaggctctcaagggcattgttgcggtg
ggggcagtggactgtgacacacacaaggaggtagctggggaatatcgcatccagggcttc
cccaccatcaagttgctatacgtcgatgacgccaccgggtccatcaaatcgttggattac
aacggcggacgtaccgccaaggatctagtcacctttgctctggacaaggccaagtccctg
gccatgaagcgcctgggcgagaaggcttcgtctggatccggatccagttctggatctagc
tctggatctggatctgggtcggacggcttttacggcggtacggatgtggtgacactgacg
tcggacaacttccgtacccaggtggtcaagagcaacgacctgtggcttgtggagatgtac
gcgccttggtgtgggcactgcaaggcccttaagcccgcctggattgaggcagcttcggag
ctggctggcaaggtcaaaatcggagctgtggattgcaccgcacaccagaccgtttgctca
gagtacggcgtccagggctaccccaccatcaagttcttcggagcggacaagcgctccccg
caggactaccagggcggcagggacagcggctccatcgtgtcgtttgcaatggccaagttc
gcggagcaggtccctcctccggagccggtggagctgaccagtcagagcgtgtttgagtcg
gagtgtttgggcgactcctccggcgccaaggcccggaggctgtgcttggtagccttcctg
cccgacctgctggactccaaggcggcgggccgcaaccgctacatcaacattctcaagaag
acggcggaggcgtacaaggacaagccgtactcgtacctgtgggtccagggcgccgttcag
gagggcttggagtccaacttcggagtcggtggatttggctacccagcgctggtggctttt
aacccggctgacaagaagtacactgtttgcaagagcgcattcgagctgaaccacgtcaag
gactggatcgaggccatgaggatggggggcaccggggcattgccgctgcagggctccctc
gcatccataaagtccatcaccccgtgggacggtcaggacgccaaggaggaggcggcggac
gagttcgacttgagcgacattctcaatgaagagctgtga

DBGET integrated database retrieval system