KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_105923Help
Entry
VOLCADRAFT_105923 CDS       T01330                                 

Definition
hypothetical protein
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vcn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    VOLCADRAFT_105923
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VOLCADRAFT_105923
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VOLCADRAFT_105923
Enzymes [BR:vcn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     VOLCADRAFT_105923
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 261 aa AA seqDB search
MNSNPRERSRSFLLSARGTQISTRLLQLSASWMRLAQMSLNLECRTRYAGKDPLADGPVI
QGAATRALEKHTTLDRVIEMVRRTAPAMKAPLVMFTYFNPIMRKGLDKFCKTIKEAGASG
LLVPDLPLEETVAVRAACEAAGIELVLLTTPTTPQARMSAIAQASQGFVYLVSLTGVTGM
KDQVESRVEGLVRTLQDVTDKPICVGFGVSRPDQAKQIVSWGANGVICGSALVKALGEAK
SPAEGLQAMEDLARSLRAAIP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaactcaaatccaagggaaaggtcgcgttcattccttttatctgcgcgggggacccag
atctcgacacgacttctgcagctctccgcaagctggatgagattggcgcagatgtcattg
aacttggagtgccgtactcggtacgctgggaaggatccgctggcagatggtcccgtcatc
caaggcgcagccactcgtgcgctggaaaagcacacgactctcgatcgcgtcattgagatg
gttcgcaggacggcgccggccatgaaggcgcccctggtcatgttcacttacttcaaccca
atcatgcggaagggcctcgacaagttctgcaagacgatcaaggaggcgggcgcatcaggc
ctcctggttccagaccttcctttggaggagacggtggctgtacgggcggcatgtgaggct
gcgggaattgagctggtcttgctgacaacgcctaccacaccacaagcccgcatgagcgcg
attgcgcaggcgagccagggcttcgtgtacctggtctcactgacgggggtgacgggcatg
aaggaccaggtggagtcgcgtgtggaggggctggtgcgcacgctgcaggacgtcacggac
aagccgatttgcgtgggcttcggtgtgtcgcgcccggaccaggcgaagcagattgtgtca
tggggtgccaacggcgtcatttgcggaagcgcccttgtgaaggcattgggtgaagccaag
tccccggcggagggtctccaagccatggaggaccttgcgcggagtttgcgcgctgctatt
ccatga

DBGET integrated database retrieval system