KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_106144Help
Entry
VOLCADRAFT_106144 CDS       T01330                                 

Definition
hypothetical protein
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
mRNA surveillance pathway
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:vcn03015]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 304 aa AA seqDB search
MDIAQVDEIIERLLDVRNGRPGKQVQLAENEIRLLCLTAKEIFMSQPNLLELEAPIKICG
DIHGQYSDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLSFKIKYPENFFLLRG
NHECASINRIYGFYDECKRRYNIRLWRTFTDCFNCLPVAALIDEKILCMHGGLSPELKSL
EQIKRITRPTDVPDSGLLCDLLWADPDKDIQGWGENDRGVSYTFGPDCVTEFLQKHDLDL
VCRAHQVVEEGYEFFAKRQLVTIFSAPNYCGEFENAGAMMSVDETLMCSFQILKPAETKQ
KGRR
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggacattgcccaagttgatgaaattatcgagcggctgttggatgtgcggaatggcagg
ccaggcaagcaagtgcagctggctgaaaacgagattcgtctgctttgcctgacggccaag
gagatctttatgagccagcccaacctgctggaactggaggcgcctattaagatttgcggt
gatattcatggccagtattcagaccttttgcgactgtttgagtatggtggctttccccct
gaggcgaattatctgttcctcggggactatgtggaccgcggcaagcagagcctggagacc
atctgcttgctgctctcgttcaagattaagtacccggaaaacttcttcttgttgcggggg
aaccacgagtgcgcgtctattaaccgtatctacggtttctatgatgaatgcaagcggaga
tacaacatccgcctctggcgcacgttcacggactgcttcaattgcctacctgttgctgcc
cttatagatgagaagattctgtgcatgcacggtggcctatcccctgagctcaagtcgttg
gagcagattaagcgaatcacgcggccaacggacgttccggactcgggcttgctgtgcgac
ctgctctgggccgacccggacaaggatattcagggctggggcgagaacgaccgtggcgtg
tcctacacgttcgggccggattgtgtcacagaattcctgcaaaagcatgacctggacctc
gtctgtcgtgcgcaccaggttgttgaagagggttatgaattcttcgcaaaacggcagctc
gtgaccatcttctcagcgcccaactattgtggcgagttcgagaatgccggtgctatgatg
agtgtcgacgaaacgcttatgtgctctttccagatcctgaagccggccgagacaaaacag
aaaggacggcgctga

DBGET integrated database retrieval system