KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_106144Help
Entry
VOLCADRAFT_106144 CDS       T01330                                 

Definition
hypothetical protein
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:vcn00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    VOLCADRAFT_106144
Enzymes [BR:vcn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     VOLCADRAFT_106144
Protein phosphatases and associated proteins [BR:vcn01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     VOLCADRAFT_106144
Transcription machinery [BR:vcn03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     VOLCADRAFT_106144
Messenger RNA biogenesis [BR:vcn03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     VOLCADRAFT_106144
Spliceosome [BR:vcn03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    VOLCADRAFT_106144
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 304 aa AA seqDB search
MDIAQVDEIIERLLDVRNGRPGKQVQLAENEIRLLCLTAKEIFMSQPNLLELEAPIKICG
DIHGQYSDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLSFKIKYPENFFLLRG
NHECASINRIYGFYDECKRRYNIRLWRTFTDCFNCLPVAALIDEKILCMHGGLSPELKSL
EQIKRITRPTDVPDSGLLCDLLWADPDKDIQGWGENDRGVSYTFGPDCVTEFLQKHDLDL
VCRAHQVVEEGYEFFAKRQLVTIFSAPNYCGEFENAGAMMSVDETLMCSFQILKPAETKQ
KGRR
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggacattgcccaagttgatgaaattatcgagcggctgttggatgtgcggaatggcagg
ccaggcaagcaagtgcagctggctgaaaacgagattcgtctgctttgcctgacggccaag
gagatctttatgagccagcccaacctgctggaactggaggcgcctattaagatttgcggt
gatattcatggccagtattcagaccttttgcgactgtttgagtatggtggctttccccct
gaggcgaattatctgttcctcggggactatgtggaccgcggcaagcagagcctggagacc
atctgcttgctgctctcgttcaagattaagtacccggaaaacttcttcttgttgcggggg
aaccacgagtgcgcgtctattaaccgtatctacggtttctatgatgaatgcaagcggaga
tacaacatccgcctctggcgcacgttcacggactgcttcaattgcctacctgttgctgcc
cttatagatgagaagattctgtgcatgcacggtggcctatcccctgagctcaagtcgttg
gagcagattaagcgaatcacgcggccaacggacgttccggactcgggcttgctgtgcgac
ctgctctgggccgacccggacaaggatattcagggctggggcgagaacgaccgtggcgtg
tcctacacgttcgggccggattgtgtcacagaattcctgcaaaagcatgacctggacctc
gtctgtcgtgcgcaccaggttgttgaagagggttatgaattcttcgcaaaacggcagctc
gtgaccatcttctcagcgcccaactattgtggcgagttcgagaatgccggtgctatgatg
agtgtcgacgaaacgcttatgtgctctttccagatcctgaagccggccgagacaaaacag
aaaggacggcgctga

DBGET integrated database retrieval system