KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_106260Help
Entry
VOLCADRAFT_106260 CDS       T01330                                 

Gene name
prfA
Definition
profilin
Orthology
K05759  
profilin
Organism
vcn  Volvox carteri f. nagariensis
Brite
Exosome [BR:vcn04147]
 Exosomal proteins
  Proteins found in most exosomes
   VOLCADRAFT_106260 (prfA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 130 aa AA seqDB search
MSWDEYITSNLMAPVDANGSTLSSAAILGLDGSVWAKSSGFPAFTPEEFEKVMAAMADPA
ITAAFFSGAKYMKVTSDETVLRCRKDKIGFIARKTNTAIVMGFYEDPPVSGQMCNRVVEA
LGDYLEHQGY
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgagctgggacgaatacatcacaagcaatcttatggctcctgttgatgctaatgggtca
acactgagcagcgctgccattttgggactggatggctctgtctgggcgaaatctagtggg
ttcccagctttcacgcctgaagagttcgagaaagtgatggcagctatggctgatccagct
ataacagctgcttttttctcgggcgccaagtacatgaaggtgacgtctgacgagactgtt
ctgcgctgccgcaaagacaagattgggttcatcgcccgcaagaccaacacggccattgtg
atgggcttctatgaggatcctccagtcagcgggcagatgtgcaaccgggttgtggaagct
ctaggcgactaccttgagcaccagggctactaa

DBGET integrated database retrieval system