KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_106272Help
Entry
VOLCADRAFT_106272 CDS       T01330                                 

Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:vcn00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    VOLCADRAFT_106272
Enzymes [BR:vcn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     VOLCADRAFT_106272
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 354 aa AA seqDB search
MRINFCSKLRSPASLHTGFPKLAASHPNRRASVAAGAREIMTTTPQKPLIVVGSVNADLV
LPIDRLPKPGETLAAASIETVPGGKGANQAAAAARSGYPTFFIGQFGKDDPNAALLRSAL
LGCGVDLSHAQDVAGPCGTALILLQAGGENSIIIVGGANQAAWSLSDGVKQLLSCAGAVL
LQREIPESVNIEVAQLAKAAGVPVVLDAGGVEGPIAPELLSCLTVLSPNETELARLTGLP
TDTEDQVRAAAEQLMSAGVQSVLVKLGSEGSLLLPGQGQTAIRQQAIKAPEVLDTTGAGD
CFTATYAVAVLEGKAAPQALQFASAAASLCVRRMGAMTSLPSRGEVEELLAAQQ
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcaacttctgctctaagctgcgcagcccagcatctctccatacgggcttccct
aagcttgcagctagccatcccaaccgtcgtgcaagtgtcgctgccggcgcccgggaaatc
atgacaacaacaccgcaaaagcctctcattgtcgtcggttcagtcaacgctgacctcgtt
cttcccatcgaccgcctcccaaagcccggcgagaccctcgcggcagcatcaattgagact
gtcccgggcggcaagggcgcaaaccaggccgctgctgcagcacgctctggctatcccacc
ttcttcatcggccagttcggcaaagacgaccccaacgcggcgctgctgcgcagcgcgttg
ctgggctgtggtgtcgatctctcacatgcccaagatgtcgcggggccctgcggcaccgcg
ttaatcctgctgcaagccggcggcgaaaactccatcatcatcgtcggtggtgctaaccaa
gccgcctggagcctctccgatggtgtgaagcagctgctttcttgcgctggagcagtgctg
ctgcagcgcgagattcccgagtcggtcaacatcgaggtggcgcagctggccaaggctgcc
ggtgtacccgtcgtactggacgctggcggcgtggagggccctatagcacccgagctgctg
tcgtgtctgacggtgttgagccccaatgagaccgagttggctcggctgacggggctgccg
accgacactgaagaccaggtccgtgcggcagcggagcagctaatgtctgcgggtgtgcag
tccgtgttggtcaagctgggcagtgagggcagcctgctgctgccaggtcagggccagaca
gccatcaggcaacaagccattaaggcgcccgaggtgctggatacgacgggcgccggggac
tgcttcaccgccacctacgcggtggccgtgttggagggcaaggccgccccacaggcgctg
cagttcgcctcggcggcggcgtctctgtgtgtacggcgcatgggcgccatgacgtcactg
ccctccagaggcgaggttgaggagctgctggcggcccagcagtag

DBGET integrated database retrieval system