KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_106794Help
Entry
VOLCADRAFT_106794 CDS       T01330                                 

Gene name
cyc6
Definition
(RefSeq) guanylyl and adenylyl cyclase family member
  KO
K11858  
ubiquitin carboxyl-terminal hydrolase 48 [EC:3.4.19.12]
Organism
vcn  Volvox carteri f. nagariensis
Brite
Enzymes [BR:vcn01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     VOLCADRAFT_106794 (cyc6)
Peptidases [BR:vcn01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   VOLCADRAFT_106794 (cyc6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 1173 aa AA seqDB search
MLPVGAGLLGTGKAYEPCLLVFRVCGSNAAAFTCIMQKISTNLSQPRLRSLSLFLGWSPR
ARRNHNKLFPLYVNGVAKSYFKISASRDYAQVLRRLLRRDPLLTFALQKAIKNLSKGDCK
PVSHVTSDPTGQSASLYGLRITPCVWSDTNGHKLPALLLEHNVPYESQDVMPRLLRDYAV
LSHVPSILTLIDFNGHVLYQNAASIDYCGDLTSHNVETGDGMMGVLFQYEPQLLQEMLQE
VNEGNYWQQVVRVPASLKRHMVFEAETTWSYGSRGGGGKKLTAAVSKRFIQDAMEPEFQL
ESFTTQHARSQRNNTARGLASLFQTQVSMARQESLGPAGAGGRGNGSPRQQAPAPQRQDT
RDSGVAIAGPAALPVGRLGSITGPAPRLASNTLTPGTSAHVAFNLPNQLEDSSPGPPAAM
AGSFTVTAAKAGGGGGGGALVPQQHSHLTNAGQNRRFMTLMQSAERQQPPSFTASLQSFN
TDGEKPESRGLLAQEECWHDISAIPLLDPVLDKQVYRGVEAYGGEAYGGRGGTALGLGLG
SEVILLLQTNVTARVELENRLADLTDAQLGMLEQLFPRHVIEYMLSHKHGYNSRNLTHLA
NHHDDVIVLFTDVVGFTSMSKEVEPSEVMHFLNELYTIFDDLVDIHDLYKLDTVGDCYIV
VAGLTMQDDDGFTCTVQGDNDQRLHHAEVMMDFAKAILRESKQVLMPHNNSPVQIRIGIH
FGSLASGLVGPKMPKFTLFGDTMNTASRMESTCKPGCVQVSEVFAKLLPFEDWQDTGGVE
VKGKGHMQTFLWIPKPEDLIPSGMGGRSPCRSGDGGGSVGSTDGAMAPAASAASSVTNGA
GLDDLATDRTDMNSTGRASAASLVRARSARAASVRPKSSRPKSSRYFTRPSTARLRESYA
GGSGSGSGGPGSTSRPSTASSGLGRMSSLGRTSLGRSTTLNRSMSRRNVSFRFQGDLPDD
DLGMEEEDANPFMAILSHIRGSNTGEPEDGGGGGGGGSGMASGHRDITAGLRISSDGENE
GDNKPQRSGPPLGAKRVSNGYSGGGALRRSGSGAMAAQVRLSSSGTPRMSNNGGMRISGP
GQGAGAGSSPGYRSLVEGSAVQAVDETEAIDELKACMVVAKAEGALKPARAVRLTFAPEM
QLPLSPTLLTHLPQQQQQQPNATATTTTMVANN
NT seq 3522 nt NT seq  +upstreamnt  +downstreamnt
atgttaccggtgggagcggggctgctgggaacaggcaaagcatacgaaccttgcctcctg
gtcttcagggtctgcggctccaacgccgcggctttcacgtgcattatgcaaaagatatcc
acaaatctgtctcaacctcgactacgaagcctatcgctgttcttgggttggagccctcga
gcgcgccgaaaccacaacaagctgttcccgctctacgttaacggcgtggcaaagtcatac
tttaaaatcagcgccagccgcgactacgcgcaggtgctccggcgcctgctgcggcgagac
ccgctgctcacatttgccctccaaaaagccattaaaaacctttcaaaaggcgactgtaag
cccgtcagccacgtcacctccgaccccaccgggcagtccgcgtcgctctatggcctccgc
atcaccccctgcgtgtggtcggacaccaacggacacaagctccccgccctcctcctggag
cacaacgtgccgtacgagtcgcaggatgtcatgccgcgcctgctccgcgactacgcagtc
ctgtcccacgtgccttccattctcacacttatagacttcaacggccacgtgttgtaccaa
aacgccgccagcattgactactgcggcgacctgaccagccacaacgtggaaaccggcgac
ggaatgatgggtgtgttgtttcagtacgagccgcagctgctgcaggagatgctgcaggag
gtgaatgagggcaactactggcagcaggtcgtgcgcgtgccggcctcgctcaagcggcac
atggtctttgaggcggaaacgacctggagctacgggagccgcggcggcggcggaaagaag
ctcactgctgccgtcagcaagcgcttcattcaggacgcgatggagccggagttccagctg
gaaagcttcacgacgcaacatgcccgcagccagcggaacaacacggcgcgcggactggcg
tccctgtttcagacgcaggttagcatggcgcggcaggagagcctggggccagcgggggcg
gggggccgtggcaatggcagcccccggcaacaggcgcctgcgccgcagcggcaggacacg
cgggacagcggcgtcgcaattgccgggccggcggcgctgcccgtgggtcgcctaggtagc
atcaccgggcctgccccgcgcctggctagcaataccctcaccccaggcaccagtgcgcac
gtcgcgttcaatctgcccaatcagctcgaagattcgtcaccgggtcccccggcggcaatg
gcggggtccttcaccgttactgccgctaaggctggtggcggcggaggcggaggcgccttg
gtgccgcagcagcactcgcacctgaccaatgccggccaaaatcggcggttcatgacgctg
atgcaatcggcggagcggcagcagccacccagcttcacggcgtcattgcagagcttcaac
acagatggggagaagcccgagtcgcgggggttgttggcgcaggaagaatgctggcatgac
atctcagcaatcccgcttctggacccggtcctggacaagcaggtataccggggggtggag
gcatacgggggggaggcgtatgggggaaggggcggcaccgcactggggttgggcttggga
agcgaggtgatactgctgctccagaccaacgtcacagcccgggtggagctggagaaccgg
ctggcggacctgacggatgcgcagctgggcatgttggagcagctcttcccccgccacgtc
atcgagtatatgctgtcccacaaacacggctacaactcccgcaacctgacccatctggcc
aaccaccacgacgacgtcattgtgctgtttacggatgtggtgggcttcacgtcgatgagt
aaggaggtcgagcccagcgaggtgatgcacttcctgaacgagctgtacaccatctttgac
gacctggtggatatccacgacctgtacaagctggacaccgtgggcgactgctacatcgtg
gtggcggggctcaccatgcaggacgacgacggcttcacgtgcacggtgcaaggggacaac
gatcaacggctgcaccacgcggaggtcatgatggactttgcaaaggccatcctgcgggag
tccaagcaggtcctcatgccgcacaataacagccctgtgcaaatacgcatcgggatccac
tttggcagcctggccagcggcttggtggggcccaagatgcccaagttcacgctgtttggg
gacacgatgaacaccgccagcaggatggaaagcacctgcaagccaggatgcgtccaggtt
tcggaggtgtttgcgaagctgcttccgttcgaggactggcaggacacgggtggcgtggag
gtcaagggaaaaggacacatgcagacctttctgtggatccccaaacccgaggacctcatc
ccgagtggtatgggaggtcgatcgccgtgccgcagcggcgatggcggcggctccgtcggc
tctacggacggcgccatggcgcctgcggccagcgctgccagctccgtcaccaacggcgcg
ggactcgatgacttggccacggaccgcacggacatgaacagcaccggtcgggccagtgct
gcatcgctagtgcgcgcccggtcagcacgtgccgcctccgttcgacccaaatcgagtcga
cccaaatcgagtcgctacttcacgcggccctcgacggcacggcttcgggaaagctatgct
ggtggcagtggcagcggtagcggcggccctggcagcacgagccgcccgagcacggccagc
agcggtctaggccgcatgtcgtccctcgggcgaaccagcctcggccggtctaccacactc
aaccggtcgatgtcgcgccgcaatgtgagtttccgcttccagggagacttaccggacgac
gatttgggcatggaggaggaggatgccaaccccttcatggccattctcagccacatccgc
ggcagcaacacgggcgagccagaggacggcggcggcggcggtggcggcggcagcggcatg
gcgtccgggcaccgagacattaccgccggcttgcgcatctctagcgatggcgagaacgaa
ggcgacaacaagccgcagcgcagcggcccgcccctgggcgccaagcgagtcagcaacggt
tactcgggaggaggggccctgcgtcggagcggcagcggcgcgatggcggcgcaggtccgg
ttgagctccagtgggacgccgcggatgagtaacaatggaggaatgcggatcagcggcccc
ggccaaggcgccggcgccggcagcagtcctggttaccggtctttagtggagggcagcgcg
gtgcaggcagtggacgagacggaagcgatagacgagctgaaggcgtgcatggtggtggcc
aaggcggagggcgcgctgaagcccgccagggccgtacggttgacgtttgcgccagagatg
cagctgccgctgtcgccgacgctattaacgcaccttccgcagcagcagcagcagcagccg
aatgccacggcgaccacgacaacgatggtggcgaacaattag

DBGET integrated database retrieval system