KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_106840Help
Entry
VOLCADRAFT_106840 CDS       T01330                                 

Definition
hypothetical protein
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:vcn01212]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:vcn00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:vcn00640]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:vcn00061]
Metabolism; Biosynthesis of other secondary metabolites; Aflatoxin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 2461 aa AA seqDB search
MPTTVDASKLPPPLPPPPWPTAAAAALLPCGPPRPPCQPATSWRGPSWRGDLDFYGGSTC
GSHSPLGSSRAGGPPGVAPRAAGEPRGPAAASRTTAVASDAAAAAEQQQEQLKQWRQQGG
VSSGGPSALEGRRPGEGCVSRSSPSSSPTLGRALRPSPPPPPLPLLPPPPPPPGAPGELE
DYVAELGGDKPIYRGHASENPELPAALTAHDIRFLGPPPGPMAALGDKIGSTLLAQAAGV
PTLPWSGSHVTVSVSECSGGIIPPAVYSAACLPVEDLEAAVAACREVGYPVMLKASWGGG
GKGIRKVSSDEEVRSVFKQVAGEVPGSPIFAMKLAPASRHLEVQLLCDMHGNVVSLFGRD
CSVQRRHQKIVEEGPVTAAPEHILRDMERCARALARLVGYVGAATVEYLYCIDEQKYYFL
ELNPRLQVEHPVTEGITGVNLPACQLLIGMGVPLTRIPYIRSLYGKDPKSSEPFDPETSP
QRPPDGHVVAVRITAEDAADGFKPTAGRIDELHFRPTPDFGHLFARGDTREAALRAMSAS
LRDGVVVRGEIRNTTDYVLDLIASPELTNNLIHTGWLDSRIAARVKPGRPPWHIAVIAGA
VVKSSAAVASASSEYLGYLAKGQLPPPGISLTHMEHTMVIEGFKYGVTLVRRGPGRAAVQ
LNGSSVAVAYRKMGDGGFLMQTCYSNLQHGDLADRAFSDQLQAMPMCQIARGCSTQCSCR
HTSAQPIIKYAFAVDGEAHVIHYEDEAAGTRLLINGLTVLLAAEVDPSRLTASSPGKIMR
RLMPSGTRVERDQPYGEMEAMKMVMPLLSPAAGVIRWVAPEGGVVAAGELIASLELDEGA
AVAAPEPYPGTFPELGPPQIMSNRVDAVLANAVESARSLLAGYVVPHEQVVEDLVTCLDS
PSLALLQWTAEFAVVRGRMPGALAAALEAAVAPHSAEVQAAVEAAEAAAIVAEGDEDGDG
AAAAAGGGGGGTGDGGNGTAAAAAEALASPRGGGGGGGGGGGGRTQPFLHVGDFPAAAVA
EVMERAMQEAPAADRAALATALEPLLRLAKAHAGGRQAYARSVVSDLLEAFLSVEEAFSA
ARRDAGDPGVTTDQEAIDALRKQHAGKLSVVLDLVLSHQGLPLKSKLVLGLMARLVLPAP
AQYRPLLRSVHVVPGLEDQIDRLVGAPAAVEDALAGLVVDATGAHALLRRRAALTYIKRL
YAPFLLREPVMQGAPEGVHLAVWLYDDPAAANTPAPRQRMGAFLLLDRLAVLPAGVTALS
AVLNKLRDDAGGAAGVGTLHVAISAVSGGASNGVGGAPRHSRTPSPPGPICLSTDSGTAG
GAAALDALLPPAEQGVELSRATAAAVAAAVAAVAATLRRLGFGAVSFLAPGTTACPLRLG
WRWIPASAASTADSTSAPVGADNGAFQPDTFMSAVEPVTATLLELSSLSAAAGGGSAAAA
ATAAGGGSGLMYRPSRNRQWHLYTAVERRDARSAPLRRLFVRGLVRSLGHPALLAASYSG
NGDAVASAAMQELEESLTNCLDELQRAAPATSAAAAADAAAAAAAAARPDWTHLFLSVLP
PLPLPPGGRDDAKVAAALRSAAAALVARHGGALRQAAVSVWETRLRGPLREGAWRVVVSM
PTGHEQGEEHVEVYREVLQLQYEQYKQNQQQLAQEQRRQLQSPSSTSMSTAATAAGATVA
AATAPQPPLRVYVPAALYPVVLTQASGADGALTGPGRHSHHVPFHVHVQAHHPAVHHGRT
LPYFAPHSYLLHPRGVSGGGGGLAASYDTAVSAASAAAAAAAASGGGALAGMVVGSPYPP
LEPLQQKRLAARRHNVTYVYDFPAVFEAALRDLWAARAAAGEPKSSPPSGRLVEAVELVL
PPQAAPGAPGGAGPCADFRNPPRLRRAPPGRPAIGGNDCGMVVWQLTLHSPECSQGRSVI
AVANDITWGSGSFSPAEDAVFRAAVETSLEERLPLLYLAANAGARVRDCLQVQWRDPSQP
ELGWEYLYLSEGDYGRLLAETPPGAPPVLRAEGYTVTLVSGRTVGIGAYLARLGRRCVQR
ADQPIVLTGYAALNKLLGRQVYTSHMQLGGPRVMGVNGVSHHVVADDLEGVRTVLQLLSY
APTQLGAPPPELATADPVTRLIGYSPGPGEKLDPRAAIAGREAPRPAPPSSAASWLESQA
GWARTVVTGRARLGGLAVGVIAVESQTVVRQQPADPGMPDSCESVIPQAGQAGSLIVERL
RTYRHPVFVYIPAGAELRGGAWVVVDSQINAAAVEVFADPSARGGVLEPEGVCEIKFRTP
DLIKMMHRAAAAALTPAAPGADAAAASAASLEAAAEAAAARLAECGGDGGGGAEECAALD
RAFVEWAESRAGRDLVAAELRSMRRSVAADMVTQVVVEEVEVVVEEVEVLGTEDGKDGLL
HALQAACLRDVTLAMQLRLLLQSLAGGGGGGGGAGGGSGGVLQQAIGHTYPHTLFGSHLG
C
NT seq 7386 nt NT seq  +upstreamnt  +downstreamnt
atgccaacgaccgtggatgcatcgaagctgccgccgccgctgccgccgccgccctggccc
accgccgccgccgcggcgctactgccctgcggccccccacgtcccccctgccagcccgcg
acctcctggcggggaccctcctggcggggggacttggacttctacggaggaagcacatgt
ggctcacacagcccccttggctcgtccagggcgggtgggcccccgggagtggcgccgagg
gcagcgggggaaccccgtgggccggcggcagcgagccgtacgaccgcagtagcatccgat
gcggcggctgccgcggagcagcagcaggagcagctaaagcagtggcggcagcaggggggg
gtatcgtcaggcggcccttcagcattggaagggaggcgcccaggggaggggtgcgtcagc
cgcagtagccccagctccagccccacgctcgggagagcgctacgtccgtctcctccgccg
cctcctcttccgctgcttccacctccacctccgccccctggggctccaggcgagctggag
gactacgtggcggagctggggggggacaaacccatctacaggggtcacgcgtcggagaac
ccggagctgcccgccgccctgacggctcacgatattcggttcctggggccccccccggga
cccatggcggctctgggggataagatcggatccacgttgttggctcaggcagccggtgtg
cccaccctcccctggagcggcagccacgtcaccgtgtccgtgtcggagtgcagcggcgga
atcatcccccccgcggtctactcggccgcctgcctccccgtggaggacctggaggcggct
gtggcggcgtgtagggaggtggggtacccggtgatgctgaaggcctcgtggggaggaggt
ggaaagggaattcgcaaggtgtcctcggacgaggaggttcgctccgtgttcaagcaggtc
gcgggggaggtgcccggctcccccatattcgcaatgaagctcgcacccgccagcaggcac
ttggaggtccagctgctgtgtgacatgcacggaaatgtggtcagcttgttcggccgtgac
tgttccgtacagcggcgccatcagaagattgtggaggaaggtcctgtcactgccgcgccg
gagcacattcttcgggacatggaacggtgcgctcgagccctggcccgcctggtgggctac
gttggcgccgcaacagtggagtacttgtactgcattgacgagcaaaagtactacttcctg
gagctgaacccgcggctgcaggtggagcatcccgtgacggagggcatcactggagtcaac
ttgcccgcgtgccagctgctcatcggcatgggggtgccgttgacacgcattccgtacatt
cggtcactgtacggcaaggacccaaagtcttcggagccgtttgacccggagacaagcccg
cagcgcccgccggacggacacgtggttgccgtacgaattacggcagaggacgccgcggac
gggtttaagcccactgcgggccgtattgacgagctgcacttccgtcccacccccgatttc
ggtcacttattcgccaggggtgacacccgcgaggcggccctccgcgccatgtcggcctcc
ctgcgtgacggagtggtggtgcggggggagatccgcaacaccacggactacgtgctggac
ctgatcgcgtcgcccgagctcaccaacaacctcatacacaccggctggctggactcccgc
attgccgcgagagtgaagccggggcgcccgccgtggcacatcgccgtgattgcgggagcg
gttgtcaagtcctcggcagcagtagcctccgccagctccgagtacctgggctacctggcc
aagggtcagctaccgcccccgggcatcagcctcacacacatggagcacaccatggttatt
gaggggttcaagtacggcgtgactctggtccgccggggcccgggtcgtgcggcggtgcag
ctgaacgggagctctgtggcggtcgcgtaccgcaagatgggggatgggggattcctaatg
cagacctgttattccaaccttcaacacggcgacttggcggacagagccttcagcgatcaa
ttgcaggctatgccaatgtgccagatcgcaagaggctgctccacgcaatgctcatgtaga
catacctcagctcaacctatcatcaaatacgcatttgcagttgacggcgaggcgcacgtc
atccactacgaggacgaggcggcgggcacccggctgctcatcaacggcctcacggtgctg
ctggcggcggaggtggacccctccaggctcacagcctcgtcacccgggaagatcatgcgc
cggctcatgccgtcggggacgcgcgtggagcgggaccagccctacggagagatggaggcc
atgaagatggtgatgccgctcctgtcccccgccgcgggggtcatccgctgggtggcgccg
gaggggggggtggtggcggcgggagagctcattgcctccctggaactggacgagggagcg
gcggtggcggctccggaaccataccccggcacgtttccggagctaggacccccgcagatc
atgtcgaatcgcgtagatgccgtactggcgaatgccgtggagtcggcacggtcactgctg
gccggttacgtggtgccgcatgagcaggtggtggaggacctggtgacctgcctggacagc
ccctcgctggcgctgttgcagtggacggcggagttcgcggtggtgcggggccggatgccg
ggagcactggcggcggcgctggaggcggcggtggcgccgcactcggcggaggtgcaggcg
gcggtggaggcggcggaggcggccgcaatcgtggcggagggagacgaggacggtgacgga
gccgccgccgccgctggcggcggcggcggtggtacgggggatggtggaaatgggacggcg
gcggcggcagcggaagctctggcgtcgccccgtggtggtggtggcggcggtggtggcggt
ggcggaggtagaactcagccgtttttgcatgtgggcgacttccctgcggcggcggtggcg
gaggtgatggagcgggctatgcaggaggcgcccgcggcggatcgtgcggctttggccaca
gccctggagccgctactgcgcctggcgaaggcccacgcggggggccgccaggcctacgcc
cgttccgtggtgagcgacctgctggaggcgttcctgtcggtggaggaggcgttcagtgcg
gcgcggcgggatgcgggcgacccgggggtcaccacggaccaggaggccattgacgcgctc
cggaagcagcatgctgggaagctgtccgtggtgctggacctggtgctgagtcaccagggt
ctccccctgaagagcaagctggtgctgggccttatggcccgtctggtgctacccgccccc
gcccaataccggcccctgctgaggagtgtgcacgtggttccgggtcttgaagaccagatc
gaccggctggttggcgccccggctgcggtggaggacgctctggcgggtctggtggtggat
gccacgggggcacacgcgctgctgcgccgccgggccgccctcacctacatcaagcgcctc
tacgcgcccttcctgcttagagagcccgtcatgcagggggcgccggagggtgtccatctg
gcggtttggttgtacgacgatcccgccgccgccaacacccctgcacccagacagcgaatg
ggtgccttcctccttctggaccgcctggcggtgctgcccgccggcgtgacggcgctgtct
gccgtactcaacaagttgcgcgacgacgccggcggcgccgcgggtgtcggcacgctacat
gtggcgatctcggccgttagcggcggcgccagcaacggggttggcggcgcgcctcgccac
agccgtacgccgtcgcctccgggcccgatatgtctcagtacggacagcggcaccgcaggc
ggcgccgccgcgctggatgcgttattgccgccggcggagcagggcgtagagctgagccgc
gctaccgccgccgccgtggcggcggcggtggcagcggtggcggcgacgctgcgccgactg
ggcttcggcgctgtcagcttccttgcgccaggcaccactgcctgcccgctgcgcctcggc
tggcgctggatccctgcctccgccgccagtacggcagacagtacttcagcgcctgtgggg
gcggacaatggcgcattccagccagacaccttcatgtccgccgtcgagcctgtgacggcg
acgctgctggagctgtccagccttagtgccgccgccggaggcggcagcgccgccgccgcc
gccacagctgcaggcggcggcagtggtttgatgtaccgtcctagccgcaaccgtcaatgg
cacctgtacacggcggtagagcggcgcgacgccaggtcggcgccgctgcggcggctgttc
gtgaggggcctagtgcgcagtctgggccatccggcgctgctggcggcgagctacagcggt
aacggcgacgcggtggcgtcggcggcgatgcaagagctggaggagtcgctgaccaactgc
ttggacgagctgcagcgcgccgcacccgccacgtcagcggccgccgccgccgacgcggcc
gctgccgcggccgcggccgctcgtcccgactggacgcacctgttcctttccgtactgccg
ccgctgccgctgccccctggcggccgcgacgacgccaaggtggcggcggcgctgcgctcg
gcggcggcggcgctggttgctcgccacggcggcgcgctacgccaggcggcggtctctgtg
tgggagacgcgactgcgcggtccactccgggagggggcctggcgtgtggtggtgtccatg
cctacgggtcatgagcaaggcgaggagcacgtggaggtgtaccgcgaggttctccagctg
cagtacgagcagtacaaacagaatcaacagcagcttgctcaggagcagcgaaggcaactg
caatcgccgtcgtcgacgtcgatgtcgacggcagcgacagcggctggcgccacggtcgcc
gctgctactgcgccgcagccgccgctgcgtgtatacgtccccgcggcgctgtaccctgtc
gtgctcacgcaggctagcggtgccgacggcgcactgacgggtcccggccgccactcccat
cacgtgcccttccacgtgcacgtgcaagcacaccatcctgccgtacaccatggtcgtaca
ctcccttacttcgccccacacagctacctcctgcacccgcggggtgtcagcggtggcggc
ggtggtttagcggcctcgtacgacacggccgtctccgccgcctctgccgccgccgccgca
gctgccgccagtggtggcggcgcgctggcggggatggtggtgggttctccgtaccctccc
ctggagccgctgcagcagaagcggctggcggcgcggcggcacaacgtgacgtacgtgtac
gactttccggcggtgtttgaggcggcgttgcgggatctgtgggccgcccgcgcggcggcg
ggtgagccaaagtcctcccccccctccggtcgcctggtggaggccgtggagctggtgctg
cccccgcaggccgctccgggcgccccggggggtgcggggccgtgcgcggacttccgtaac
ccgccccgcctgcggagagcccccccgggccgccccgccataggggggaatgactgcggt
atggtggtgtggcagctgacgttgcacagcccggagtgctcgcagggtcgctccgtcatc
gcggtggccaacgacatcacgtggggcagcggctccttcagccccgcggaggacgcggtg
ttccgggcggccgtggagacctccctggaggagaggctgccgctgctgtacctggcggcc
aatgcgggagccagggtccgagactgcctgcaggtgcagtggcgggacccctcccaaccc
gagctggggtgggagtacctgtacctcagcgagggcgactacgggcggctgctggcggag
acaccgccgggggcaccgccggtactgcgggctgagggctacacggtgacgctggtttcg
gggcgcactgtgggtattggcgcctaccttgctcgcctgggtcgccgctgcgtgcagcgg
gcggatcagcccattgtgttgaccgggtatgcggcgctgaataagctgctggggaggcag
gtatacaccagccacatgcagctggggggtccgcgggttatgggggtgaatggagtgtcg
catcacgtggtggcagatgacctggagggggtccgtactgtactgcaactgctgtcgtac
gcaccgacccaactgggcgccccgcctcctgagctggctacagccgaccccgtcacccgc
ctcattggctacagcccggggcccggggagaagctggacccccgggcggccatcgcgggt
cgcgaggcgccccgacctgctcccccctcctccgccgcctcctggttagagagccaggcg
ggctgggctcgtacggtggtgacgggccgagctcgtttgggcggcttggcggtgggggtg
atagcggtggagagccagacggttgtacggcagcaaccggcggacccgggtatgccggac
tcgtgcgagagcgttattccgcaggccgggcaggccggcagtctcatagtcgagcgactg
cgcacctaccgccacccggtctttgtgtacatacctgccggggctgagctcagggggggt
gcctgggtggtggtggacagtcagatcaatgcggccgcggtggaggtgttcgcggacccc
tcagcgcgggggggtgtgctggagccggagggtgtgtgcgagatcaagttccgtacaccc
gacctgatcaagatgatgcaccgcgccgctgccgcggcgctgacaccggcggcgccgggt
gccgatgccgccgccgcgtcagcagcctccctggaggctgctgcggaggctgctgcagct
cgcctggcggagtgcggtggtgatggtggtggtggagctgaggaatgcgctgctctcgac
cgggcctttgttgagtgggctgagagccgtgcaggtcgggacctggtggcggcggagctg
aggtccatgaggcggagtgtggcggcggatatggtcacgcaggtggtggtggaggaggtg
gaggtggtggtggaggaggtggaggttctgggcaccgaggacggcaaggacgggctgctc
cacgcgctgcaggcggcctgtctgcgggacgtcactctggccatgcagttgaggttgctg
cttcagtccttggctgggggcggcggcggcggcggcggcgctggcggcggcagtggtggt
gtcctgcagcaggcgatcggccacacctacccgcacacgctctttggctcccaccttggc
tgttaa

DBGET integrated database retrieval system