KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_106840Help
Entry
VOLCADRAFT_106840 CDS       T01330                                 

Definition
(RefSeq) hypothetical protein
  KO
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:vcn00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    VOLCADRAFT_106840
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VOLCADRAFT_106840
   00640 Propanoate metabolism
    VOLCADRAFT_106840
  Lipid metabolism
   00061 Fatty acid biosynthesis
    VOLCADRAFT_106840
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    VOLCADRAFT_106840
Enzymes [BR:vcn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     VOLCADRAFT_106840
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     VOLCADRAFT_106840
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 2461 aa AA seqDB search
MPTTVDASKLPPPLPPPPWPTAAAAALLPCGPPRPPCQPATSWRGPSWRGDLDFYGGSTC
GSHSPLGSSRAGGPPGVAPRAAGEPRGPAAASRTTAVASDAAAAAEQQQEQLKQWRQQGG
VSSGGPSALEGRRPGEGCVSRSSPSSSPTLGRALRPSPPPPPLPLLPPPPPPPGAPGELE
DYVAELGGDKPIYRGHASENPELPAALTAHDIRFLGPPPGPMAALGDKIGSTLLAQAAGV
PTLPWSGSHVTVSVSECSGGIIPPAVYSAACLPVEDLEAAVAACREVGYPVMLKASWGGG
GKGIRKVSSDEEVRSVFKQVAGEVPGSPIFAMKLAPASRHLEVQLLCDMHGNVVSLFGRD
CSVQRRHQKIVEEGPVTAAPEHILRDMERCARALARLVGYVGAATVEYLYCIDEQKYYFL
ELNPRLQVEHPVTEGITGVNLPACQLLIGMGVPLTRIPYIRSLYGKDPKSSEPFDPETSP
QRPPDGHVVAVRITAEDAADGFKPTAGRIDELHFRPTPDFGHLFARGDTREAALRAMSAS
LRDGVVVRGEIRNTTDYVLDLIASPELTNNLIHTGWLDSRIAARVKPGRPPWHIAVIAGA
VVKSSAAVASASSEYLGYLAKGQLPPPGISLTHMEHTMVIEGFKYGVTLVRRGPGRAAVQ
LNGSSVAVAYRKMGDGGFLMQTCYSNLQHGDLADRAFSDQLQAMPMCQIARGCSTQCSCR
HTSAQPIIKYAFAVDGEAHVIHYEDEAAGTRLLINGLTVLLAAEVDPSRLTASSPGKIMR
RLMPSGTRVERDQPYGEMEAMKMVMPLLSPAAGVIRWVAPEGGVVAAGELIASLELDEGA
AVAAPEPYPGTFPELGPPQIMSNRVDAVLANAVESARSLLAGYVVPHEQVVEDLVTCLDS
PSLALLQWTAEFAVVRGRMPGALAAALEAAVAPHSAEVQAAVEAAEAAAIVAEGDEDGDG
AAAAAGGGGGGTGDGGNGTAAAAAEALASPRGGGGGGGGGGGGRTQPFLHVGDFPAAAVA
EVMERAMQEAPAADRAALATALEPLLRLAKAHAGGRQAYARSVVSDLLEAFLSVEEAFSA
ARRDAGDPGVTTDQEAIDALRKQHAGKLSVVLDLVLSHQGLPLKSKLVLGLMARLVLPAP
AQYRPLLRSVHVVPGLEDQIDRLVGAPAAVEDALAGLVVDATGAHALLRRRAALTYIKRL
YAPFLLREPVMQGAPEGVHLAVWLYDDPAAANTPAPRQRMGAFLLLDRLAVLPAGVTALS
AVLNKLRDDAGGAAGVGTLHVAISAVSGGASNGVGGAPRHSRTPSPPGPICLSTDSGTAG
GAAALDALLPPAEQGVELSRATAAAVAAAVAAVAATLRRLGFGAVSFLAPGTTACPLRLG
WRWIPASAASTADSTSAPVGADNGAFQPDTFMSAVEPVTATLLELSSLSAAAGGGSAAAA
ATAAGGGSGLMYRPSRNRQWHLYTAVERRDARSAPLRRLFVRGLVRSLGHPALLAASYSG
NGDAVASAAMQELEESLTNCLDELQRAAPATSAAAAADAAAAAAAAARPDWTHLFLSVLP
PLPLPPGGRDDAKVAAALRSAAAALVARHGGALRQAAVSVWETRLRGPLREGAWRVVVSM
PTGHEQGEEHVEVYREVLQLQYEQYKQNQQQLAQEQRRQLQSPSSTSMSTAATAAGATVA
AATAPQPPLRVYVPAALYPVVLTQASGADGALTGPGRHSHHVPFHVHVQAHHPAVHHGRT
LPYFAPHSYLLHPRGVSGGGGGLAASYDTAVSAASAAAAAAAASGGGALAGMVVGSPYPP
LEPLQQKRLAARRHNVTYVYDFPAVFEAALRDLWAARAAAGEPKSSPPSGRLVEAVELVL
PPQAAPGAPGGAGPCADFRNPPRLRRAPPGRPAIGGNDCGMVVWQLTLHSPECSQGRSVI
AVANDITWGSGSFSPAEDAVFRAAVETSLEERLPLLYLAANAGARVRDCLQVQWRDPSQP
ELGWEYLYLSEGDYGRLLAETPPGAPPVLRAEGYTVTLVSGRTVGIGAYLARLGRRCVQR
ADQPIVLTGYAALNKLLGRQVYTSHMQLGGPRVMGVNGVSHHVVADDLEGVRTVLQLLSY
APTQLGAPPPELATADPVTRLIGYSPGPGEKLDPRAAIAGREAPRPAPPSSAASWLESQA
GWARTVVTGRARLGGLAVGVIAVESQTVVRQQPADPGMPDSCESVIPQAGQAGSLIVERL
RTYRHPVFVYIPAGAELRGGAWVVVDSQINAAAVEVFADPSARGGVLEPEGVCEIKFRTP
DLIKMMHRAAAAALTPAAPGADAAAASAASLEAAAEAAAARLAECGGDGGGGAEECAALD
RAFVEWAESRAGRDLVAAELRSMRRSVAADMVTQVVVEEVEVVVEEVEVLGTEDGKDGLL
HALQAACLRDVTLAMQLRLLLQSLAGGGGGGGGAGGGSGGVLQQAIGHTYPHTLFGSHLG
C
NT seq 7386 nt NT seq  +upstreamnt  +downstreamnt
atgccaacgaccgtggatgcatcgaagctgccgccgccgctgccgccgccgccctggccc
accgccgccgccgcggcgctactgccctgcggccccccacgtcccccctgccagcccgcg
acctcctggcggggaccctcctggcggggggacttggacttctacggaggaagcacatgt
ggctcacacagcccccttggctcgtccagggcgggtgggcccccgggagtggcgccgagg
gcagcgggggaaccccgtgggccggcggcagcgagccgtacgaccgcagtagcatccgat
gcggcggctgccgcggagcagcagcaggagcagctaaagcagtggcggcagcaggggggg
gtatcgtcaggcggcccttcagcattggaagggaggcgcccaggggaggggtgcgtcagc
cgcagtagccccagctccagccccacgctcgggagagcgctacgtccgtctcctccgccg
cctcctcttccgctgcttccacctccacctccgccccctggggctccaggcgagctggag
gactacgtggcggagctggggggggacaaacccatctacaggggtcacgcgtcggagaac
ccggagctgcccgccgccctgacggctcacgatattcggttcctggggccccccccggga
cccatggcggctctgggggataagatcggatccacgttgttggctcaggcagccggtgtg
cccaccctcccctggagcggcagccacgtcaccgtgtccgtgtcggagtgcagcggcgga
atcatcccccccgcggtctactcggccgcctgcctccccgtggaggacctggaggcggct
gtggcggcgtgtagggaggtggggtacccggtgatgctgaaggcctcgtggggaggaggt
ggaaagggaattcgcaaggtgtcctcggacgaggaggttcgctccgtgttcaagcaggtc
gcgggggaggtgcccggctcccccatattcgcaatgaagctcgcacccgccagcaggcac
ttggaggtccagctgctgtgtgacatgcacggaaatgtggtcagcttgttcggccgtgac
tgttccgtacagcggcgccatcagaagattgtggaggaaggtcctgtcactgccgcgccg
gagcacattcttcgggacatggaacggtgcgctcgagccctggcccgcctggtgggctac
gttggcgccgcaacagtggagtacttgtactgcattgacgagcaaaagtactacttcctg
gagctgaacccgcggctgcaggtggagcatcccgtgacggagggcatcactggagtcaac
ttgcccgcgtgccagctgctcatcggcatgggggtgccgttgacacgcattccgtacatt
cggtcactgtacggcaaggacccaaagtcttcggagccgtttgacccggagacaagcccg
cagcgcccgccggacggacacgtggttgccgtacgaattacggcagaggacgccgcggac
gggtttaagcccactgcgggccgtattgacgagctgcacttccgtcccacccccgatttc
ggtcacttattcgccaggggtgacacccgcgaggcggccctccgcgccatgtcggcctcc
ctgcgtgacggagtggtggtgcggggggagatccgcaacaccacggactacgtgctggac
ctgatcgcgtcgcccgagctcaccaacaacctcatacacaccggctggctggactcccgc
attgccgcgagagtgaagccggggcgcccgccgtggcacatcgccgtgattgcgggagcg
gttgtcaagtcctcggcagcagtagcctccgccagctccgagtacctgggctacctggcc
aagggtcagctaccgcccccgggcatcagcctcacacacatggagcacaccatggttatt
gaggggttcaagtacggcgtgactctggtccgccggggcccgggtcgtgcggcggtgcag
ctgaacgggagctctgtggcggtcgcgtaccgcaagatgggggatgggggattcctaatg
cagacctgttattccaaccttcaacacggcgacttggcggacagagccttcagcgatcaa
ttgcaggctatgccaatgtgccagatcgcaagaggctgctccacgcaatgctcatgtaga
catacctcagctcaacctatcatcaaatacgcatttgcagttgacggcgaggcgcacgtc
atccactacgaggacgaggcggcgggcacccggctgctcatcaacggcctcacggtgctg
ctggcggcggaggtggacccctccaggctcacagcctcgtcacccgggaagatcatgcgc
cggctcatgccgtcggggacgcgcgtggagcgggaccagccctacggagagatggaggcc
atgaagatggtgatgccgctcctgtcccccgccgcgggggtcatccgctgggtggcgccg
gaggggggggtggtggcggcgggagagctcattgcctccctggaactggacgagggagcg
gcggtggcggctccggaaccataccccggcacgtttccggagctaggacccccgcagatc
atgtcgaatcgcgtagatgccgtactggcgaatgccgtggagtcggcacggtcactgctg
gccggttacgtggtgccgcatgagcaggtggtggaggacctggtgacctgcctggacagc
ccctcgctggcgctgttgcagtggacggcggagttcgcggtggtgcggggccggatgccg
ggagcactggcggcggcgctggaggcggcggtggcgccgcactcggcggaggtgcaggcg
gcggtggaggcggcggaggcggccgcaatcgtggcggagggagacgaggacggtgacgga
gccgccgccgccgctggcggcggcggcggtggtacgggggatggtggaaatgggacggcg
gcggcggcagcggaagctctggcgtcgccccgtggtggtggtggcggcggtggtggcggt
ggcggaggtagaactcagccgtttttgcatgtgggcgacttccctgcggcggcggtggcg
gaggtgatggagcgggctatgcaggaggcgcccgcggcggatcgtgcggctttggccaca
gccctggagccgctactgcgcctggcgaaggcccacgcggggggccgccaggcctacgcc
cgttccgtggtgagcgacctgctggaggcgttcctgtcggtggaggaggcgttcagtgcg
gcgcggcgggatgcgggcgacccgggggtcaccacggaccaggaggccattgacgcgctc
cggaagcagcatgctgggaagctgtccgtggtgctggacctggtgctgagtcaccagggt
ctccccctgaagagcaagctggtgctgggccttatggcccgtctggtgctacccgccccc
gcccaataccggcccctgctgaggagtgtgcacgtggttccgggtcttgaagaccagatc
gaccggctggttggcgccccggctgcggtggaggacgctctggcgggtctggtggtggat
gccacgggggcacacgcgctgctgcgccgccgggccgccctcacctacatcaagcgcctc
tacgcgcccttcctgcttagagagcccgtcatgcagggggcgccggagggtgtccatctg
gcggtttggttgtacgacgatcccgccgccgccaacacccctgcacccagacagcgaatg
ggtgccttcctccttctggaccgcctggcggtgctgcccgccggcgtgacggcgctgtct
gccgtactcaacaagttgcgcgacgacgccggcggcgccgcgggtgtcggcacgctacat
gtggcgatctcggccgttagcggcggcgccagcaacggggttggcggcgcgcctcgccac
agccgtacgccgtcgcctccgggcccgatatgtctcagtacggacagcggcaccgcaggc
ggcgccgccgcgctggatgcgttattgccgccggcggagcagggcgtagagctgagccgc
gctaccgccgccgccgtggcggcggcggtggcagcggtggcggcgacgctgcgccgactg
ggcttcggcgctgtcagcttccttgcgccaggcaccactgcctgcccgctgcgcctcggc
tggcgctggatccctgcctccgccgccagtacggcagacagtacttcagcgcctgtgggg
gcggacaatggcgcattccagccagacaccttcatgtccgccgtcgagcctgtgacggcg
acgctgctggagctgtccagccttagtgccgccgccggaggcggcagcgccgccgccgcc
gccacagctgcaggcggcggcagtggtttgatgtaccgtcctagccgcaaccgtcaatgg
cacctgtacacggcggtagagcggcgcgacgccaggtcggcgccgctgcggcggctgttc
gtgaggggcctagtgcgcagtctgggccatccggcgctgctggcggcgagctacagcggt
aacggcgacgcggtggcgtcggcggcgatgcaagagctggaggagtcgctgaccaactgc
ttggacgagctgcagcgcgccgcacccgccacgtcagcggccgccgccgccgacgcggcc
gctgccgcggccgcggccgctcgtcccgactggacgcacctgttcctttccgtactgccg
ccgctgccgctgccccctggcggccgcgacgacgccaaggtggcggcggcgctgcgctcg
gcggcggcggcgctggttgctcgccacggcggcgcgctacgccaggcggcggtctctgtg
tgggagacgcgactgcgcggtccactccgggagggggcctggcgtgtggtggtgtccatg
cctacgggtcatgagcaaggcgaggagcacgtggaggtgtaccgcgaggttctccagctg
cagtacgagcagtacaaacagaatcaacagcagcttgctcaggagcagcgaaggcaactg
caatcgccgtcgtcgacgtcgatgtcgacggcagcgacagcggctggcgccacggtcgcc
gctgctactgcgccgcagccgccgctgcgtgtatacgtccccgcggcgctgtaccctgtc
gtgctcacgcaggctagcggtgccgacggcgcactgacgggtcccggccgccactcccat
cacgtgcccttccacgtgcacgtgcaagcacaccatcctgccgtacaccatggtcgtaca
ctcccttacttcgccccacacagctacctcctgcacccgcggggtgtcagcggtggcggc
ggtggtttagcggcctcgtacgacacggccgtctccgccgcctctgccgccgccgccgca
gctgccgccagtggtggcggcgcgctggcggggatggtggtgggttctccgtaccctccc
ctggagccgctgcagcagaagcggctggcggcgcggcggcacaacgtgacgtacgtgtac
gactttccggcggtgtttgaggcggcgttgcgggatctgtgggccgcccgcgcggcggcg
ggtgagccaaagtcctcccccccctccggtcgcctggtggaggccgtggagctggtgctg
cccccgcaggccgctccgggcgccccggggggtgcggggccgtgcgcggacttccgtaac
ccgccccgcctgcggagagcccccccgggccgccccgccataggggggaatgactgcggt
atggtggtgtggcagctgacgttgcacagcccggagtgctcgcagggtcgctccgtcatc
gcggtggccaacgacatcacgtggggcagcggctccttcagccccgcggaggacgcggtg
ttccgggcggccgtggagacctccctggaggagaggctgccgctgctgtacctggcggcc
aatgcgggagccagggtccgagactgcctgcaggtgcagtggcgggacccctcccaaccc
gagctggggtgggagtacctgtacctcagcgagggcgactacgggcggctgctggcggag
acaccgccgggggcaccgccggtactgcgggctgagggctacacggtgacgctggtttcg
gggcgcactgtgggtattggcgcctaccttgctcgcctgggtcgccgctgcgtgcagcgg
gcggatcagcccattgtgttgaccgggtatgcggcgctgaataagctgctggggaggcag
gtatacaccagccacatgcagctggggggtccgcgggttatgggggtgaatggagtgtcg
catcacgtggtggcagatgacctggagggggtccgtactgtactgcaactgctgtcgtac
gcaccgacccaactgggcgccccgcctcctgagctggctacagccgaccccgtcacccgc
ctcattggctacagcccggggcccggggagaagctggacccccgggcggccatcgcgggt
cgcgaggcgccccgacctgctcccccctcctccgccgcctcctggttagagagccaggcg
ggctgggctcgtacggtggtgacgggccgagctcgtttgggcggcttggcggtgggggtg
atagcggtggagagccagacggttgtacggcagcaaccggcggacccgggtatgccggac
tcgtgcgagagcgttattccgcaggccgggcaggccggcagtctcatagtcgagcgactg
cgcacctaccgccacccggtctttgtgtacatacctgccggggctgagctcagggggggt
gcctgggtggtggtggacagtcagatcaatgcggccgcggtggaggtgttcgcggacccc
tcagcgcgggggggtgtgctggagccggagggtgtgtgcgagatcaagttccgtacaccc
gacctgatcaagatgatgcaccgcgccgctgccgcggcgctgacaccggcggcgccgggt
gccgatgccgccgccgcgtcagcagcctccctggaggctgctgcggaggctgctgcagct
cgcctggcggagtgcggtggtgatggtggtggtggagctgaggaatgcgctgctctcgac
cgggcctttgttgagtgggctgagagccgtgcaggtcgggacctggtggcggcggagctg
aggtccatgaggcggagtgtggcggcggatatggtcacgcaggtggtggtggaggaggtg
gaggtggtggtggaggaggtggaggttctgggcaccgaggacggcaaggacgggctgctc
cacgcgctgcaggcggcctgtctgcgggacgtcactctggccatgcagttgaggttgctg
cttcagtccttggctgggggcggcggcggcggcggcggcgctggcggcggcagtggtggt
gtcctgcagcaggcgatcggccacacctacccgcacacgctctttggctcccaccttggc
tgttaa

DBGET integrated database retrieval system