KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_106957Help
Entry
VOLCADRAFT_106957 CDS       T01330                                 

Gene name
adi1
Definition
aci-reductone dioxygenase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vcn00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    VOLCADRAFT_106957 (adi1)
Enzymes [BR:vcn01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     VOLCADRAFT_106957 (adi1)
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     VOLCADRAFT_106957 (adi1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 208 aa AA seqDB search
MASEPTQEELALAQPDPPESAAIDAWYMDDSSEDQRLPHRRSPNEPCPLSKLRELGVLYW
RLDADKYETDPRLAAIRKVHNYSYMEIVNISPTTLPNYDEKIKMFYEEHIHSDDEIRYVL
DGSGYFDVRDLEDRWIRIDCRKGDLIVLPEGIYHRFTLDTNNYTKAMRLFVGAPIWTPYN
RPQEEHASRQRYLEKFSGAAALEAAVSA
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctgagcccacacaagaggagcttgcgcttgcacagccggatccacctgagtcc
gccgcgatcgatgcgtggtacatggatgactcctccgaagatcagcgacttccccatcgg
cggagtcccaatgaaccctgcccactgtccaagcttcgggagctaggtgtcctatactgg
cggttggacgctgacaagtacgagacggatccgaggctggctgccatccggaaagtgcac
aactattcgtacatggaaattgttaacatctcccccaccacgcttccaaactacgatgag
aaaatcaagatgttttacgaggagcacattcactccgatgacgagattcgctacgtgtta
gatggctcaggctacttcgatgtacgggatctggaagaccgttggatccggatcgactgc
cgtaagggtgatctgattgtgttgccggagggcatctaccaccgcttcaccctcgacacc
aacaactataccaaggcgatgcggcttttcgtcggtgcgcccatatggacgccgtacaac
cggcctcaggaggagcacgcctcccgtcagcgctacttggagaagttctccggggcagca
gcgctggaggcggccgtgagcgcgtga

DBGET integrated database retrieval system