KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_107092Help
Entry
VOLCADRAFT_107092 CDS       T01330                                 

Gene name
chlD
Definition
magnesium chelatase subunit D chloroplast precursor
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:vcn00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 702 aa AA seqDB search
MKVSESDSVGFDAEVSTRLSRSYPLAAVVGQDNIKQALLLGAVDTGLGGIAIAGRRGTAK
SIMARGLHALLPPIEVVEGSFCNADPEDPRSWEAGLAGKIGAGPVKAKLRSAPFVQIPLG
VTEDRLVGTVDIEASMKEGRTVFQPGLLAEAHRGILYVDEINLLDDGIANLLLSILSDGV
NVVEREGISISHPCRPLLIATYNPEEGALREHLLDRIAITLSADVPSAFDDRVKAIDAAM
RFQDKPQDTIDETSELTDALRTSVILAREYLKEVNIAPEQVTYLVEEARRGGVQGHRAEL
YAVKVAKACAALEGRERVNKDDLRQAVQLVILPRATILDQPPQEEQPPPPPPPPPPPPPQ
DNMEEEDQDEKEEEKEEEDKENDNQDQPEIPQEFMFEAEGVIIDPSVLMFAQQQQRAQGR
SGRAKTLIFSDDRGRYIKPMLPKGDKVKRLAVDATLRAAAPYQKIRRQQAISEGKQQRKV
YVDKPDMRSKKLARKAGALVIFVVDASGSMALNRMSAAKGACMRLLAESYTSRDQVCLIP
FYGDRAEVLLPPSKSIAMARRRLDSLPCGGGSPLAHGLSTAVRVGMQASQAGEVGRVMMV
LITDGRANVSLAKSNEDPEALKPDAPKPAADQLKDEVRDMAKKAAAAGINTLVIDTENKF
VSTGFAEEIAKAAQGKYYYLPNASDAAIAAAASTAMAAAKAL
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtgtcagaatcagactcggtcggcttcgacgcggaggtttcgacacggttgtct
cgctcgtaccccctggcggccgtggtgggccaggacaatatcaagcaggcgctgctactg
ggtgccgtggacactgggctgggaggtattgctatagcaggccgccgcggtacggccaag
tccatcatggctcgcggcctgcacgcgctgctgcctcccattgaggtggtggaaggcagc
ttctgcaacgcggatccggaggatccccgctcatgggaggccggcctggctggaaagatc
ggcgcggggcccgtcaaggccaagctgcgatccgctccgttcgtacagatccccctgggt
gtcacggaggaccgcctggtgggcaccgtggatatcgaggcgtccatgaaggagggccgc
accgtgttccagcctggtcttcttgctgaggcccaccgcggcatcctgtacgtggacgag
atcaacctgctggacgacggcatcgccaatctgctgctgtccattctgtcggatggcgtc
aatgtggtggagcgggagggcatctcgatcagccacccttgccgtcctctcctgattgcc
acgtacaaccccgaggagggcgccctccgcgagcacctgttggaccgcatcgccatcacc
ctgtcagccgatgtgccatctgccttcgatgaccgagtcaaggcaatcgacgcagccatg
cgcttccaggacaagccgcaggacaccattgacgagacttcggagctgacggacgcgctg
cgcacctcggtcatcctggcgcgtgaatacctgaaggaggtcaacattgctcctgagcag
gtgacgtacctcgtggaggaggcccgccgcggcggtgtgcagggtcaccgcgccgagctt
tacgctgtcaaggtggccaaggcatgcgccgcgctagagggccgcgagcgcgtcaacaag
gacgacctgcgccaggcggtgcagctggtcatcctgccccgggccaccatcttggaccag
ccgccgcaggaggagcagccaccgccgccgccgcccccaccgccgccgccgccgccgcag
gacaacatggaggaggaggaccaagacgagaaggaggaagagaaggaagaggaggacaaa
gagaacgacaaccaagaccagcctgagatccctcaggagttcatgttcgaggcggagggc
gtcatcatcgacccctccgtcctcatgtttgcacagcagcaacagcgggcgcagggccgt
agcggccgcgccaagacgctcattttctcggacgaccgcggccggtacatcaagcccatg
ctccccaagggcgataaagtcaagcgccttgcggtggacgccactctgcgcgccgcggcg
ccgtaccaaaagattcggcggcagcaggccatcagcgagggcaagcagcagcgcaaggtg
tatgtggacaagccggatatgcgttccaagaagctcgcacgcaaggccggcgccctcgtt
atcttcgtggtggacgccagcggctccatggcgctgaaccgcatgagcgcagccaaggga
gcgtgcatgagactgctggcagagtcgtacacgtcacgtgaccaggtctgcctcattccc
ttctacggggacagggccgaggtgctgcttccgccttcaaagtcgattgccatggcccgc
cgccgcctggactcgctaccctgcggtggcggctcccccctagcacatggcctgtccacg
gccgtgcgtgtcggtatgcaggcttcccaggcgggtgaggtgggtcgcgtgatgatggtc
ctgatcacggatggccgcgccaacgtgagcttggccaagtcgaacgaggatccggaggcg
ctcaaacccgacgcgcccaagcccgccgctgaccagctcaaggacgaggtgcgcgacatg
gccaagaaggccgccgcggctgggatcaacacgctggtcattgacacggagaacaagttc
gtgagcacggggttcgcggaggagatcgcgaaggcggcgcagggcaagtactactacctg
ccgaatgcatccgacgccgccatcgcggcagctgccagcacagctatggcggcagccaag
gcgctgtga

DBGET integrated database retrieval system