KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_107549Help
Entry
VOLCADRAFT_107549 CDS       T01330                                 

Definition
hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:vcn00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 311 aa AA seqDB search
MLAYAARSRRGYSSILAAAALSGTAYAALNIDEKLAVKAVHADAPAGKGALDPNEFRAFK
LKEKRQLTRNTFLYRFELPEGQTSGIFVASCLVTRAMLKAKPEDEKPKAVIRPYTPTSPP
DAKGYLDLVVKVYDKGVMSKHIDSLKIGDSLEIKGPIKKYPYEANTKKHIGMVAGGTGIT
PMLQVIDAILDNPNDKTQVSLVYANVSESDIILQDKIDALAAQHPGRFKVYYVVDKPAWG
GLFWRGGVGYLTKDMLSKHLPAPAKDSLVMVCGPPGMMEAVSGNKAPDYSQGEVKGLLKE
LGYDSSSVFKF
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgcttgcctacgcagcgcgctcccggcggggatacagctccatccttgcggccgcagcc
ctttctggcactgcatatgcagctctgaacattgatgaaaagctagccgttaaggctgta
catgcggatgcgccagcgggcaagggtgcattggatccgaacgagttccgcgcctttaag
ctgaaggagaagcggcagctcacgcggaacactttcttgtataggttcgagctcccggag
ggtcagacttcgggcatcttcgtggcctcatgcctcgtgactcgcgcaatgctgaaggcg
aaaccggaggatgagaaacccaaggcggtcattcggccgtacaccccgacttcgccaccg
gatgccaagggctacctggaccttgtcgtcaaggtgtacgacaagggcgtcatgtcgaag
cacatcgactccctcaagatcggtgacagtttggagattaaggggcccattaaaaaatac
ccttacgaagccaacactaagaagcatattggtatggtggcgggaggaactggcatcacc
ccaatgctgcaggtcattgatgcgattttggacaacccgaatgacaagacgcaggtgtcg
ctggtgtatgccaacgtcagcgagtcggacattatcctccaggacaaaatcgacgctcta
gccgcacaacacccgggccgcttcaaggtgtactacgtggttgacaagcctgcttggggc
ggtttgttctggcgcggtggcgttggctacctaactaaggacatgctatccaagcacctg
ccggcccccgccaaggattcgctggtgatggtgtgtggccctccgggtatgatggaggca
gtgtcgggcaacaaggcacctgactactcgcagggtgaggttaagggcttgctcaaggag
ctgggctatgactcatccagcgtgttcaagttttaa

DBGET integrated database retrieval system