KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_107582Help
Entry
VOLCADRAFT_107582 CDS       T01330                                 

Definition
(RefSeq) hypothetical protein
  KO
K00605  
aminomethyltransferase [EC:2.1.2.10]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
Glycine, serine and threonine metabolism
Glyoxylate and dicarboxylate metabolism
One carbon pool by folate
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:vcn00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    VOLCADRAFT_107582
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VOLCADRAFT_107582
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    VOLCADRAFT_107582
Enzymes [BR:vcn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     VOLCADRAFT_107582
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 420 aa AA seqDB search
MSSTRRLLTLLPQLGRAGALRASEHASATGSLLFTRGFADDANLKKTVLYDFHVANGGKM
VPFAGWSMPIQYKDSIMESTIFCRKNASLFDVSHMCGLTLKGKDAIKFLEGLVVGDIAGL
KDGTGSLSVFTNEQGGIIDDTVITKVNGQEIYVVVNAGCRDKDLAHLDKHLQAAKSKGLD
VALTVHDDRSLLALQGPAAKDVLGALAPGVDLAAMYFSDFRTFDVAGIPCWVTRTGYTGE
DGFEISVPSTHAVALAEKLTASERVRLAGLGPRDSLRLEAGLCLYGNDLNESLTPVEAGL
AWTIGKRRREGFDFLGGDVIKKQLAEGVSKRRVGFVSSGAPARQHSVISTPDGQVVGEVT
SGAFSPCLKKNIAMGYVEKDFSKPGTQLKVEVRGKQNEAVVTKMPFLPTPYYKRPEAAKK
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgacgcgccgcctactcacgctcttgccccagctgggccgtgctggcgcgctt
cgtgcgtctgagcacgcatccgcgaccggctcgctactgttcacacgcggatttgccgat
gatgctaacctgaagaagacagtgctgtatgacttccatgtagccaatggaggcaagatg
gtgcccttcgccggctggtcgatgccgatccagtacaaggacagcatcatggaatccaca
attttttgccgaaagaatgcatctctttttgacgtgtcccacatgtgtgggctcacgctc
aagggcaaagacgcgatcaagttccttgagggccttgtggtgggcgacatcgctgggctc
aaggatggcaccggctcgctctcggtgttcaccaacgagcagggcggcatcatcgacgac
accgtcatcaccaaggtcaatggccaggagatctacgtggtggtgaatgcgggctgccgg
gataaggacttggcgcacctggacaagcacctgcaggcggccaagtccaagggcctggac
gtggccctgacggtccacgacgaccggagtctgctcgccctgcagggcccggctgccaag
gacgtgctgggcgccctggctccaggggtggatctggccgccatgtacttcagcgacttc
aggacgttcgacgtggcgggtatcccctgctgggttacacgcacgggctacacgggcgag
gacgggtttgagatcagtgtgccctccactcacgcggtggcgctggcggagaagctcacc
gccagcgagcgagtgcggcttgcgggtctgggcccacgtgactctctgcgtttggaagcg
ggtttgtgcctgtacggcaatgacctgaacgagtctctgacgcccgtggaggcggggctg
gcgtggaccatcggcaagcggcggcgggagggcttcgacttcctggggggtgacgtcatc
aagaaacagctggcagagggagtcagtaagcggcgtgtgggtttcgtgagcagcggcgcc
cccgcccggcagcacagcgtcatcagcacaccggacggtcaggtggtgggcgaggtgacc
agcggggccttcagtccctgcctcaagaagaacatcgccatggggtatgtggagaaggac
ttctccaagcctggcactcagctcaaggtggaggtgcgcggcaagcaaaatgaagccgtc
gtcacgaagatgcccttcttgcccacgccctactacaagcgccctgaagccgccaagaag
taa

DBGET integrated database retrieval system