KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_108106Help
Entry
VOLCADRAFT_108106 CDS       T01330                                 

Gene name
eif4E
Definition
eukaryotic translation initiation factor 4E
Orthology
K03259  
translation initiation factor 4E
Organism
vcn  Volvox carteri f. nagariensis
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:vcn00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    VOLCADRAFT_108106 (eif4E)
Messenger RNA biogenesis [BR:vcn03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     VOLCADRAFT_108106 (eif4E)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     VOLCADRAFT_108106 (eif4E)
Translation factors [BR:vcn03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    VOLCADRAFT_108106 (eif4E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 206 aa AA seqDB search
MSDPKEESREEGEVDSLEPDFSKKHPLENRWTLWFDNPNQKQTQKQYGQSLRSVYTFDTV
EDFWCLYNNIRTPSQVNVGATYYLFKEGIEPKWEDAKNLKGGCWTAPVPGKGDSKKLLDA
WWLNSVLACIGEQFTDGDEINGIAVVIRTRGDRIELWTRTASNEAAQTMVGKQLKQFLDI
SDSQKIGFSVFEEKIASGKAKDRYMV
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaccccaaggaggaaagccgtgaggagggcgaggtcgactctcttgagccagac
tttagcaagaagcatcccctagagaaccgctggacgctatggtttgacaaccccaaccag
aagcagacgcagaaacagtatgggcaatcgctcagatcggtgtataccttcgatactgtg
gaggacttctggtgcctgtacaacaacatccgcacgccgagccaagtcaatgttggagca
acctattatctgtttaaggaggggatagaacccaagtgggaggacgctaagaacttgaaa
ggcggctgctggactgcgccagtgccgggcaagggcgatagcaaaaagctgcttgacgcc
tggtggttgaactcggtgctggcctgcatcggtgagcagttcacggacggcgacgagatc
aatggtatcgccgtcgtgattaggacccgtggtgatcgcattgagctatggacgcggact
gcgtcgaacgaggcggctcagacgatggtcggcaagcagctaaagcagttcctggatatc
tcggactcgcagaagattggcttctcggtctttgaggagaaaattgcctccggcaaggcg
aaggaccgatacatggtctaa

DBGET integrated database retrieval system