KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_108106Help
Entry
VOLCADRAFT_108106 CDS       T01330                                 

Gene name
eif4E
Definition
eukaryotic translation initiation factor 4E
Orthology
K03259  
translation initiation factor 4E
Organism
vcn  Volvox carteri f. nagariensis
Pathway
RNA transport
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:vcn03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 206 aa AA seqDB search
MSDPKEESREEGEVDSLEPDFSKKHPLENRWTLWFDNPNQKQTQKQYGQSLRSVYTFDTV
EDFWCLYNNIRTPSQVNVGATYYLFKEGIEPKWEDAKNLKGGCWTAPVPGKGDSKKLLDA
WWLNSVLACIGEQFTDGDEINGIAVVIRTRGDRIELWTRTASNEAAQTMVGKQLKQFLDI
SDSQKIGFSVFEEKIASGKAKDRYMV
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaccccaaggaggaaagccgtgaggagggcgaggtcgactctcttgagccagac
tttagcaagaagcatcccctagagaaccgctggacgctatggtttgacaaccccaaccag
aagcagacgcagaaacagtatgggcaatcgctcagatcggtgtataccttcgatactgtg
gaggacttctggtgcctgtacaacaacatccgcacgccgagccaagtcaatgttggagca
acctattatctgtttaaggaggggatagaacccaagtgggaggacgctaagaacttgaaa
ggcggctgctggactgcgccagtgccgggcaagggcgatagcaaaaagctgcttgacgcc
tggtggttgaactcggtgctggcctgcatcggtgagcagttcacggacggcgacgagatc
aatggtatcgccgtcgtgattaggacccgtggtgatcgcattgagctatggacgcggact
gcgtcgaacgaggcggctcagacgatggtcggcaagcagctaaagcagttcctggatatc
tcggactcgcagaagattggcttctcggtctttgaggagaaaattgcctccggcaaggcg
aaggaccgatacatggtctaa

DBGET integrated database retrieval system