KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_108163Help
Entry
VOLCADRAFT_108163 CDS       T01330                                 

Definition
hypothetical protein
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
vcn  Volvox carteri f. nagariensis
Brite
Enzymes [BR:vcn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     VOLCADRAFT_108163
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 557 aa AA seqDB search
MVDTGKSPEPFPTADGMDGSAQAPKRRRMGSTSVTPATSPHTSQLGPNADGISLGAVAGG
PHTATDGADSKPAGGASAPPGLPGTPGMSPPPAVPIGKGAKVVGKGGNLVLSRGGGGGTA
NKGKAGGGGNRGGGGGGRGGGSMAFDDVMDSGTILVQGKTGEVRLPLDIGTRVDCKWRDG
AYHTVRVIERRNFGDPGDPRGWDYYVHYLGFNRRMDEWVTLAQLDLFTAEVEQPLEGPAD
KKGQKKKVAAEEHESDSEHADFDPTALREHEEFTKVKNIETIELGRHQMDTWYFSPFPPE
YKDCKQLYFCEFSLHFFKRRSQMIRHMSKCGMRHPPGNEIYRNSNICMFEVDGKKEKAFC
QNLCYLAKLFLDHKTLYYDVDLFLFYILCELDERGAHIVGYFSKEKCSEEGYNLACILTL
PAYQRKGYGKFLISMSYELSKIEGKVGTPERPLSDLGRVSYHGYWTRELLAILREAEGSI
SIKELSDLTAIKPDDIINTLQTLGLIQYQKGQHVICAAPKLIEKHLKAAGGPGLVVDPTK
IVWTPYNAERDYANFGR
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggtagatacgggtaaaagcccggaaccttttccaacagcagatggcatggacggctcc
gcgcaggcgcccaagcgccggcgcatgggctccaccagcgtcacccccgcgacctcccca
cacaccagccagctcggccctaacgccgacggcattagcttaggtgccgtagccggcggc
ccgcacacggccaccgacggcgccgactccaaacccgccggcggcgcctccgctcctccc
gggctgcccggaaccccgggcatgtcccccccgccagcggtgcccatcggcaaaggcgcc
aaagtggtgggtaagggcggcaacctagtcctcagccgcggcggcggcggcggcaccgct
aacaaaggcaaggctggcggcggcggcaatcgcggcggcggcggcggcggccgtggcggc
ggcagtatggcttttgatgatgtgatggactcggggacgattttggtgcagggcaagacc
ggggaggtccgcctcccgctggacatcggcacccgcgtggattgcaagtggcgagatggg
gcttaccacacggtccgggtcattgagcggcggaatttcggtgacccgggcgacccgcgg
ggctgggactactacgtccactacctaggattcaaccggcgcatggacgagtgggtaact
cttgcccaattggatttgttcaccgcggaggtggagcagccgttggagggacccgcggac
aagaagggtcagaagaagaaggtggcggctgaagagcacgagagcgacagcgagcatgcg
gacttcgatccgacggcacttcgcgagcatgaggagttcaccaaggtcaagaacatcgag
accatcgagctgggacgtcaccagatggatacctggtacttctccccgtttccccccgag
tacaaggactgcaagcagctctacttttgcgagttcagtctgcacttcttcaagcgccgc
tcgcagatgatccggcacatgagcaagtgcggcatgcgccacccgccaggcaacgaaatc
taccgcaacagcaacatctgcatgttcgaggtggacggcaagaaggagaaggcgttctgc
cagaatctgtgctacctagccaaactgttcctggaccacaagacgctctactacgatgtc
gacctgttcctcttttacatcctctgcgagctcgacgagcgcggtgcacacatcgtgggc
tacttctccaaggagaagtgcagcgaggaggggtacaatctggcctgcatcctaacgctg
cccgcctaccagcgcaagggctacggcaaatttctcatttctatgagctatgagctgtcc
aagatcgagggcaaggttggcaccccagagcggcccctttcggacctgggccgggtgtct
taccacggctactggacccgggagctactggccattctgcgcgaggccgaggggtccatc
tccatcaaggagttgtccgaccttaccgccatcaagcccgatgacatcatcaacacgctg
cagacgctcggcctcatccagtaccagaagggtcagcacgtcatctgtgcggcgcccaag
ttgatcgagaagcacctcaaggcggctggagggcccgggctcgtggtggaccccaccaag
atcgtgtggacaccctacaacgcggaacgggattacgccaactttgggcgctaa

DBGET integrated database retrieval system