KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_108380Help
Entry
VOLCADRAFT_108380 CDS       T01330                                 

Definition
hypothetical protein
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:vcn00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    VOLCADRAFT_108380
Enzymes [BR:vcn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     VOLCADRAFT_108380
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 833 aa AA seqDB search
MISVLRACFLARWGLGLPLIFVLTGYVSAAYFTYSDVTELSAANFDQLVVNSDGVALVHF
YAPGNPQCKSLASRINSVASNLKGIALVGAVDCTDKEAAGNLCQRYNVRGFPAVKLFGPD
RTKNPYTGEVMKEPSDYTGDRTSKDLKEAVTRLLTDVHITRVRSTADLEQMRAAAEAAGK
PQVLLFTDKEAATPVYKGLSMQLRRGLAFGMVVVAAGDEGGPAAEREGVLRKFGVESLPS
LLVVKAGGAVETYTGENKAPALGEFLMGFMSSEALGAGGGSAGADGEGPDGSGKATAWSF
VRQVDSLIADLPSLEAREDMTLLAVHGADGEEGCQVARETFLAAAGEMQEAEQADWTERN
GAPYPTCPDPTPPAVVDTWLASVPPEDLAPGSKGAAALSRIGVEVKELAENPCELQVVLL
PFGKGKADIQLRYTGPPDGKELQRWVTAELPPEAHRVVQLTDDVTSDFLTTDPSEGKMGV
APKADLSHYNRDRQSSWGVLLFTNRDEVPGVYKALAVALRDRANMAFGWVQANSPAARST
INSFKPPRVPALLVVLPTIVPGDEDAEGSGGGGGPRVSFGMQPYFGPLKYGPMRAFLEQL
AEQIEASAGVVTDPGVIEKTLPQITNQAEFQSYCTEPAGMCLLALLDRTAPGFEDERKHL
LAAASFGVLSSDLPVLVALSTRRMRFGVLHSREAESSRGSPRLRPELVSRFITDVLSAKI
RTQPLQDLPEIRKGDTSSDHAAARDTGRAAAPEEPAAGAGAVEEEFDLNDILSEEVEGGA
GLGGTKAERLQEIEEQLKAEEEARRAAEKAKKSSSKKKKKKGGKKSNKSKEEL
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
atgatatccgtgcttagggcgtgcttccttgcaagatgggggctgggcttgcccttgatc
ttcgtgcttacaggctacgtgtccgccgcatacttcacgtacagtgatgtcacggagctt
agtgcagctaattttgatcaacttgtcgtgaactcggatggcgtagcactggttcatttc
tatgcacctgggaatccgcaatgcaaaagcctggcgtcaaggataaactcggtagcctcc
aatctaaagggtattgcactcgtgggtgctgtggactgtacggacaaggaagccgccggc
aacctgtgccagcggtacaacgtccgaggcttcccggccgtcaagttgttcggacctgac
cgtacgaagaatccgtacactggggaagtgatgaaggagccgtccgattacaccggtgac
cggacctccaaggacctcaaggaggcggtcacgcgcctgttgactgacgtacacatcaca
cgagtacggagtactgcggatctggagcaaatgagggccgcggcggaggcggcgggcaaa
ccgcaggtgttgttattcactgacaaggaggcggcgacccccgtgtacaagggcctgtcc
atgcagctgaggagggggctggcgttcgggatggtggtggtggcggcgggggatgaaggg
ggtcccgctgcggagcgtgagggggtgctgaggaagttcggggtggagagcctcccttcg
ttgctggtggtaaaggccgggggcgctgtggaaacgtacacgggcgagaacaaggcgccg
gcgcttggggagttcctgatgggtttcatgagctcggaagccctgggggcggggggaggt
tctgcaggcgctgacggcgaagggcccgacggcagcggcaaggcgaccgcctggtcattt
gtacggcaggtggatagtctcatcgctgacctgccctccctggaggcgcgggaggacatg
accctgctggcggtgcatggagcggacggtgaggagggctgccaggtcgcccgggagact
ttcctggccgccgcgggtgagatgcaggaggccgagcaggccgactggactgagcgcaac
ggagccccttacccgacctgccctgacccgacccctcctgcggtagtggacacatggttg
gcttccgtgccccccgaggacctggcacccggctcgaagggggcggcggcattgagccgc
atcggggtggaggtgaaggagctggcggagaacccgtgcgagctgcaggtagtgttgctg
ccctttggtaagggcaaggcggatatccagcttagatacacggggccccccgacggcaag
gagctgcagcggtgggtcaccgcagagctgccccccgaggcgcaccgcgtggtgcagctg
acagatgacgtcacctcggacttcctcactaccgacccgtccgaggggaagatgggggtg
gcgccaaaggcagatctctctcactacaaccgggaccgtcaatcatcatggggggtgctg
ctgttcaccaaccgggatgaggtccccggtgtgtacaaggccctggcagtggcgctgagg
gaccgagcgaacatggcgtttggatgggtgcaggcaaacagccccgccgcccgctcgacc
atcaactccttcaaacctccacgggtgcctgcactacttgtcgtactgcccaccattgtg
ccgggtgatgaagatgctgagggaagtggcggtgggggtggtccccgggttagtttcggc
atgcagccgtacttcggtccgctcaagtacggccccatgagggcctttctggagcagctg
gccgaacagatagaggcatctgcgggtgtggtgaccgaccccggggtgattgagaagacg
ttgccgcagatcaccaaccaggctgagttccagtcgtactgtacggagcccgcgggtatg
tgcctactggcgctgctggacaggacagcgccgggatttgaggacgagcgcaagcacctg
ttggccgcggcctcgttcggggtgctgtccagcgacctgcccgtgctggtggcgctgtcc
acacgcaggatgaggttcggagtactgcactcgcgagaggcggagagctcccgggggtcc
ccccgtctccgtcccgagctggtgtcccgcttcatcacagacgtgctgagtgccaagatc
aggacacagccgctgcaggacctgccggagatccgcaagggtgacacctcctccgaccat
gctgccgccagggacacagggcgggcggctgcacctgaagaaccggctgccggtgccggt
gccgtggaggaggagtttgaccttaacgacatcttgtctgaggaggtggagggcggtgcg
gggctcggggggactaaggcggagagactgcaggaaattgaggagcagctcaaggcggag
gaggaggctcgtagggcggctgagaaggccaagaagagcagtagcaagaaaaagaaaaag
aagggtggcaagaagagcaacaagagcaaggaggaactatga

DBGET integrated database retrieval system