KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_108842Help
Entry
VOLCADRAFT_108842 CDS       T01330                                 

Gene name
aep1
Definition
hypothetical protein
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vcn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VOLCADRAFT_108842 (aep1)
   00052 Galactose metabolism
    VOLCADRAFT_108842 (aep1)
Enzymes [BR:vcn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     VOLCADRAFT_108842 (aep1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 386 aa AA seqDB search
MRILAGLLLGSSVALAALTLLRVRARRDQSWHSGLPVFTLKNVNGMEVQISAFGAAILNI
LVPDKKGNRADVVLGYDTVQEYETTTPCTYFGVVVGRVANRIANARFTLEGTEYRLLAND
GPNCLHGGLKGLHKRVWEGRLIRGADYDAVQLHYDSPEGEEGFPGTLHVSVTYRLTRNAN
ELTTSIVATSDEATPVNIAQHSYLNLGGHASGPVLSHLLRLHGADHYTPVSPSLIPTGEI
APVAGTPFDFTAAEPGSALPAHSIGSRIDEVPGAAPGGYDHNYVLFGMGPQVGGGGWPKL
AATLVDPVSGRAMDLFTTAPGVQFYSGNFLDGTIVGKGGVKYGKHAGLCLETQGFPNAVN
EPAFPSVVLRPQDTYRHELVYRFYNV
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatccttgccggtttattgttagggtccagcgtcgcgcttgcagcgctgaccctg
ttacgggtccgtgctcgccgtgaccagtcgtggcactctggattgcccgtcttcacgttg
aagaatgtcaacgggatggaggtgcaaatctcggctttcggtgcagctatccttaatatt
ctcgttcctgacaagaaagggaacagggccgatgttgtcctgggctatgatactgttcaa
gagtatgagaccaccaccccctgtacctacttcggtgtggtggttggtcgggtagccaac
cgaatcgccaacgcccggttcaccttggaggggacggagtaccgcctgctggccaacgat
gggcccaactgcctgcatggcggcttgaagggactacacaagcgagtgtgggagggacga
cttatccggggagctgactatgatgccgtacagctgcactacgacagccccgagggagag
gagggcttccccggcacgctgcatgtgagcgttacataccgcctgactcgtaacgccaac
gagctcaccacgagcatcgtggccacctcggacgaggccacgccagtcaacattgcacag
cactcttacctcaacttgggcggccacgcctccggcccggtgttgagccacctgttgcgt
ctgcacggcgccgaccactacactccggtgtcgccttcgctcatacccacgggggagatt
gcgccggtggcgggcacccccttcgacttcaccgccgcggagccggggagcgccctgccg
gctcactccatcggcagccgtatcgacgaggttcctggtgcagcgcctggagggtacgac
cacaactatgtgctgttcggcatggggccacaggtgggtggtggtggatggcccaagctc
gccgccacgttggttgacccggtcagcggtcgggccatggacctgttcaccactgcacct
ggggtgcagttttactcgggcaacttcctcgacggcacgatcgtgggcaagggcggtgtc
aagtacggcaaacacgcaggtctttgcctcgagacacagggcttccccaacgcggtcaac
gagccggccttccccagcgtcgtgctgcgaccgcaggatacctaccgccacgagctcgtc
taccgcttctacaatgtttga

DBGET integrated database retrieval system