KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_108842Help
Entry
VOLCADRAFT_108842 CDS       T01330                                 

Gene name
aep1
Definition
(RefSeq) hypothetical protein
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
vcn00010  Glycolysis / Gluconeogenesis
vcn00052  Galactose metabolism
vcn01100  Metabolic pathways
vcn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vcn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VOLCADRAFT_108842 (aep1)
   00052 Galactose metabolism
    VOLCADRAFT_108842 (aep1)
Enzymes [BR:vcn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     VOLCADRAFT_108842 (aep1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 9621383
NCBI-ProteinID: XP_002945807
JGI: 108842
UniProt: D8THZ6
Position
Unknown
AA seq 386 aa AA seqDB search
MRILAGLLLGSSVALAALTLLRVRARRDQSWHSGLPVFTLKNVNGMEVQISAFGAAILNI
LVPDKKGNRADVVLGYDTVQEYETTTPCTYFGVVVGRVANRIANARFTLEGTEYRLLAND
GPNCLHGGLKGLHKRVWEGRLIRGADYDAVQLHYDSPEGEEGFPGTLHVSVTYRLTRNAN
ELTTSIVATSDEATPVNIAQHSYLNLGGHASGPVLSHLLRLHGADHYTPVSPSLIPTGEI
APVAGTPFDFTAAEPGSALPAHSIGSRIDEVPGAAPGGYDHNYVLFGMGPQVGGGGWPKL
AATLVDPVSGRAMDLFTTAPGVQFYSGNFLDGTIVGKGGVKYGKHAGLCLETQGFPNAVN
EPAFPSVVLRPQDTYRHELVYRFYNV
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatccttgccggtttattgttagggtccagcgtcgcgcttgcagcgctgaccctg
ttacgggtccgtgctcgccgtgaccagtcgtggcactctggattgcccgtcttcacgttg
aagaatgtcaacgggatggaggtgcaaatctcggctttcggtgcagctatccttaatatt
ctcgttcctgacaagaaagggaacagggccgatgttgtcctgggctatgatactgttcaa
gagtatgagaccaccaccccctgtacctacttcggtgtggtggttggtcgggtagccaac
cgaatcgccaacgcccggttcaccttggaggggacggagtaccgcctgctggccaacgat
gggcccaactgcctgcatggcggcttgaagggactacacaagcgagtgtgggagggacga
cttatccggggagctgactatgatgccgtacagctgcactacgacagccccgagggagag
gagggcttccccggcacgctgcatgtgagcgttacataccgcctgactcgtaacgccaac
gagctcaccacgagcatcgtggccacctcggacgaggccacgccagtcaacattgcacag
cactcttacctcaacttgggcggccacgcctccggcccggtgttgagccacctgttgcgt
ctgcacggcgccgaccactacactccggtgtcgccttcgctcatacccacgggggagatt
gcgccggtggcgggcacccccttcgacttcaccgccgcggagccggggagcgccctgccg
gctcactccatcggcagccgtatcgacgaggttcctggtgcagcgcctggagggtacgac
cacaactatgtgctgttcggcatggggccacaggtgggtggtggtggatggcccaagctc
gccgccacgttggttgacccggtcagcggtcgggccatggacctgttcaccactgcacct
ggggtgcagttttactcgggcaacttcctcgacggcacgatcgtgggcaagggcggtgtc
aagtacggcaaacacgcaggtctttgcctcgagacacagggcttccccaacgcggtcaac
gagccggccttccccagcgtcgtgctgcgaccgcaggatacctaccgccacgagctcgtc
taccgcttctacaatgtttga

DBGET integrated database retrieval system