KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_109454Help
Entry
VOLCADRAFT_109454 CDS       T01330                                 

Definition
hypothetical protein
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:vcn01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:vcn00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:vcn00630]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 546 aa AA seqDB search
MAVQTVPGVAILGPVAAEHADILTPEAQLFVATLHRVFNPRRKELLKRRELRQKELDAGR
LPDFLPETAAVRASPAWRCAPPAPGLVDRRVEITGPVDRKMVINAFNSGATQYMADFEDS
HAPTWANNLDGHVNLRDAIRRTISYTAPNGKQYRLRGDGKLATLLVRPRGWHLEEAHFLV
DGEPCSGSMFDFGLFFFHNARAILAVGEGPYFYLPKMESHLEARLWNDVFNAAQDMIRIP
RGTIRATVLIETLLAAFEMEEILFELRDHSAGLNCGRWDYIFSFIKKLRNHRQYVLPDRS
AVTMTSHFMDSYVRLLIKTCHKRGVHAMGGMAAQIPIKDDPAANAAALAKVRADKEREVT
AGHDGTWVAHPELVKIALEVFNKHMPQPNQLHIRRDDVNVTAADLLCVGGGQLLADGGIT
ERGLRDNLSVGLAYMESWLRGVGCVPIHNLMEDAATAEISRSQVWQWVRHGAITREGRVV
SAPWVTQILQEEVEAAKAKLGAQRFAASKYELAARLLAGTITGGPYSDFLTTLCYEHIVT
KPISRM
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atggctgtccagactgttcccggtgttgccattttgggacctgtcgctgcggagcacgcc
gacatcctcacccccgaagcgcagctctttgtggcaacactgcaccgcgtgttcaacccg
cgtcgcaaggagcttctgaagcgccgcgaattgcgtcagaaggagcttgacgccggcagg
ctgcctgacttcctgccggagactgccgccgtgcgagcctcgcctgcatggcgctgcgct
ccgccagcccctggcctcgtggatcgccgtgtggaaatcacaggccccgttgaccgaaag
atggtcatcaacgcctttaactcgggcgccacccagtatatggctgactttgaggattcc
cacgccccgacgtgggccaacaacttggatggccatgtgaacctgcgagacgctattcgc
cgtaccatctcgtacacggcccccaacggaaagcagtaccgcctgcgcggcgacggcaag
ctggctaccttgcttgtacgccctcgcggatggcacctggaagaggctcacttccttgtg
gatggagagccctgttcgggatcaatgtttgactttggcctctttttctttcacaacgcc
cgggctatccttgctgtgggcgaggggccgtacttctacctgcccaagatggagagccat
ctggaggccaggttgtggaatgacgtctttaatgcggcccaggacatgatccgcatcccc
cgcggcactatccgcgccaccgtcctcattgagacgctgctggcggcgtttgagatggaa
gaaattctattcgagctccgagaccactctgctggactcaactgcggccgctgggactac
attttctccttcatcaagaagctccggaaccaccgccagtacgtgctgccggaccgctcg
gcggtgacaatgacgtcgcatttcatggactcgtacgtgcgcctgctcattaagacgtgc
cataagcgcggtgtgcacgccatgggcggtatggcggcccagatcccaattaaggacgac
cctgctgccaacgccgcagccctggccaaggtccgtgctgacaaggagcgcgaggtgact
gcgggccatgatggcacctgggtggcgcacccagagctcgtcaagatagcgctcgaggtg
ttcaacaagcacatgccgcagcccaaccagctgcacatccggcgtgatgacgtgaatgtg
actgcggccgacctgctgtgtgtcggcggtggtcagctgctggcggatggcggcatcacc
gagcgcggtttgcgtgacaacctcagtgtgggcctagcctacatggagagctggctccgg
ggagtgggctgtgtgcccatccacaacctcatggaagatgccgccacggctgagattagc
aggtcccaggtgtggcagtgggtgcggcacggtgccatcactcgtgagggccgggtggtg
agcgccccatgggtcacccagatcctgcaggaggaggtggaggcggctaaggccaagttg
ggcgctcagcgcttcgccgcgtccaagtacgagctggcggcccggctgctggcgggcacc
atcacggggggcccctacagtgacttcctgaccacgctgtgctacgagcacattgtcacc
aagcccatctcgcgcatgtaa

DBGET integrated database retrieval system