KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_109454Help
Entry
VOLCADRAFT_109454 CDS       T01330                                 

Definition
hypothetical protein
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:vcn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    VOLCADRAFT_109454
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VOLCADRAFT_109454
   00630 Glyoxylate and dicarboxylate metabolism
    VOLCADRAFT_109454
Enzymes [BR:vcn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     VOLCADRAFT_109454
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 546 aa AA seqDB search
MAVQTVPGVAILGPVAAEHADILTPEAQLFVATLHRVFNPRRKELLKRRELRQKELDAGR
LPDFLPETAAVRASPAWRCAPPAPGLVDRRVEITGPVDRKMVINAFNSGATQYMADFEDS
HAPTWANNLDGHVNLRDAIRRTISYTAPNGKQYRLRGDGKLATLLVRPRGWHLEEAHFLV
DGEPCSGSMFDFGLFFFHNARAILAVGEGPYFYLPKMESHLEARLWNDVFNAAQDMIRIP
RGTIRATVLIETLLAAFEMEEILFELRDHSAGLNCGRWDYIFSFIKKLRNHRQYVLPDRS
AVTMTSHFMDSYVRLLIKTCHKRGVHAMGGMAAQIPIKDDPAANAAALAKVRADKEREVT
AGHDGTWVAHPELVKIALEVFNKHMPQPNQLHIRRDDVNVTAADLLCVGGGQLLADGGIT
ERGLRDNLSVGLAYMESWLRGVGCVPIHNLMEDAATAEISRSQVWQWVRHGAITREGRVV
SAPWVTQILQEEVEAAKAKLGAQRFAASKYELAARLLAGTITGGPYSDFLTTLCYEHIVT
KPISRM
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atggctgtccagactgttcccggtgttgccattttgggacctgtcgctgcggagcacgcc
gacatcctcacccccgaagcgcagctctttgtggcaacactgcaccgcgtgttcaacccg
cgtcgcaaggagcttctgaagcgccgcgaattgcgtcagaaggagcttgacgccggcagg
ctgcctgacttcctgccggagactgccgccgtgcgagcctcgcctgcatggcgctgcgct
ccgccagcccctggcctcgtggatcgccgtgtggaaatcacaggccccgttgaccgaaag
atggtcatcaacgcctttaactcgggcgccacccagtatatggctgactttgaggattcc
cacgccccgacgtgggccaacaacttggatggccatgtgaacctgcgagacgctattcgc
cgtaccatctcgtacacggcccccaacggaaagcagtaccgcctgcgcggcgacggcaag
ctggctaccttgcttgtacgccctcgcggatggcacctggaagaggctcacttccttgtg
gatggagagccctgttcgggatcaatgtttgactttggcctctttttctttcacaacgcc
cgggctatccttgctgtgggcgaggggccgtacttctacctgcccaagatggagagccat
ctggaggccaggttgtggaatgacgtctttaatgcggcccaggacatgatccgcatcccc
cgcggcactatccgcgccaccgtcctcattgagacgctgctggcggcgtttgagatggaa
gaaattctattcgagctccgagaccactctgctggactcaactgcggccgctgggactac
attttctccttcatcaagaagctccggaaccaccgccagtacgtgctgccggaccgctcg
gcggtgacaatgacgtcgcatttcatggactcgtacgtgcgcctgctcattaagacgtgc
cataagcgcggtgtgcacgccatgggcggtatggcggcccagatcccaattaaggacgac
cctgctgccaacgccgcagccctggccaaggtccgtgctgacaaggagcgcgaggtgact
gcgggccatgatggcacctgggtggcgcacccagagctcgtcaagatagcgctcgaggtg
ttcaacaagcacatgccgcagcccaaccagctgcacatccggcgtgatgacgtgaatgtg
actgcggccgacctgctgtgtgtcggcggtggtcagctgctggcggatggcggcatcacc
gagcgcggtttgcgtgacaacctcagtgtgggcctagcctacatggagagctggctccgg
ggagtgggctgtgtgcccatccacaacctcatggaagatgccgccacggctgagattagc
aggtcccaggtgtggcagtgggtgcggcacggtgccatcactcgtgagggccgggtggtg
agcgccccatgggtcacccagatcctgcaggaggaggtggaggcggctaaggccaagttg
ggcgctcagcgcttcgccgcgtccaagtacgagctggcggcccggctgctggcgggcacc
atcacggggggcccctacagtgacttcctgaccacgctgtgctacgagcacattgtcacc
aagcccatctcgcgcatgtaa

DBGET integrated database retrieval system