KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_109454Help
Entry
VOLCADRAFT_109454 CDS       T01330                                 

Definition
(RefSeq) hypothetical protein
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
vcn00620  Pyruvate metabolism
vcn00630  Glyoxylate and dicarboxylate metabolism
vcn01100  Metabolic pathways
vcn01110  Biosynthesis of secondary metabolites
vcn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:vcn00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    VOLCADRAFT_109454
   00630 Glyoxylate and dicarboxylate metabolism
    VOLCADRAFT_109454
Enzymes [BR:vcn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     VOLCADRAFT_109454
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI S4
Motif
Other DBs
NCBI-GeneID: 9627984
NCBI-ProteinID: XP_002958508
JGI: 109454
UniProt: D8UIP0
Position
Unknown
AA seq 546 aa AA seqDB search
MAVQTVPGVAILGPVAAEHADILTPEAQLFVATLHRVFNPRRKELLKRRELRQKELDAGR
LPDFLPETAAVRASPAWRCAPPAPGLVDRRVEITGPVDRKMVINAFNSGATQYMADFEDS
HAPTWANNLDGHVNLRDAIRRTISYTAPNGKQYRLRGDGKLATLLVRPRGWHLEEAHFLV
DGEPCSGSMFDFGLFFFHNARAILAVGEGPYFYLPKMESHLEARLWNDVFNAAQDMIRIP
RGTIRATVLIETLLAAFEMEEILFELRDHSAGLNCGRWDYIFSFIKKLRNHRQYVLPDRS
AVTMTSHFMDSYVRLLIKTCHKRGVHAMGGMAAQIPIKDDPAANAAALAKVRADKEREVT
AGHDGTWVAHPELVKIALEVFNKHMPQPNQLHIRRDDVNVTAADLLCVGGGQLLADGGIT
ERGLRDNLSVGLAYMESWLRGVGCVPIHNLMEDAATAEISRSQVWQWVRHGAITREGRVV
SAPWVTQILQEEVEAAKAKLGAQRFAASKYELAARLLAGTITGGPYSDFLTTLCYEHIVT
KPISRM
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atggctgtccagactgttcccggtgttgccattttgggacctgtcgctgcggagcacgcc
gacatcctcacccccgaagcgcagctctttgtggcaacactgcaccgcgtgttcaacccg
cgtcgcaaggagcttctgaagcgccgcgaattgcgtcagaaggagcttgacgccggcagg
ctgcctgacttcctgccggagactgccgccgtgcgagcctcgcctgcatggcgctgcgct
ccgccagcccctggcctcgtggatcgccgtgtggaaatcacaggccccgttgaccgaaag
atggtcatcaacgcctttaactcgggcgccacccagtatatggctgactttgaggattcc
cacgccccgacgtgggccaacaacttggatggccatgtgaacctgcgagacgctattcgc
cgtaccatctcgtacacggcccccaacggaaagcagtaccgcctgcgcggcgacggcaag
ctggctaccttgcttgtacgccctcgcggatggcacctggaagaggctcacttccttgtg
gatggagagccctgttcgggatcaatgtttgactttggcctctttttctttcacaacgcc
cgggctatccttgctgtgggcgaggggccgtacttctacctgcccaagatggagagccat
ctggaggccaggttgtggaatgacgtctttaatgcggcccaggacatgatccgcatcccc
cgcggcactatccgcgccaccgtcctcattgagacgctgctggcggcgtttgagatggaa
gaaattctattcgagctccgagaccactctgctggactcaactgcggccgctgggactac
attttctccttcatcaagaagctccggaaccaccgccagtacgtgctgccggaccgctcg
gcggtgacaatgacgtcgcatttcatggactcgtacgtgcgcctgctcattaagacgtgc
cataagcgcggtgtgcacgccatgggcggtatggcggcccagatcccaattaaggacgac
cctgctgccaacgccgcagccctggccaaggtccgtgctgacaaggagcgcgaggtgact
gcgggccatgatggcacctgggtggcgcacccagagctcgtcaagatagcgctcgaggtg
ttcaacaagcacatgccgcagcccaaccagctgcacatccggcgtgatgacgtgaatgtg
actgcggccgacctgctgtgtgtcggcggtggtcagctgctggcggatggcggcatcacc
gagcgcggtttgcgtgacaacctcagtgtgggcctagcctacatggagagctggctccgg
ggagtgggctgtgtgcccatccacaacctcatggaagatgccgccacggctgagattagc
aggtcccaggtgtggcagtgggtgcggcacggtgccatcactcgtgagggccgggtggtg
agcgccccatgggtcacccagatcctgcaggaggaggtggaggcggctaaggccaagttg
ggcgctcagcgcttcgccgcgtccaagtacgagctggcggcccggctgctggcgggcacc
atcacggggggcccctacagtgacttcctgaccacgctgtgctacgagcacattgtcacc
aagcccatctcgcgcatgtaa

DBGET integrated database retrieval system