KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_109718Help
Entry
VOLCADRAFT_109718 CDS       T01330                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:vcn00010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 330 aa AA seqDB search
MAFSSMRSTMRCGARPCLRTPAKAARRTTTIVASSVSELNTKYGIPGSVEFKEGKSGSPV
VVLKHACGSTAEMYLFGACVTSWKQPSGDEILYVRPDAVFDKSKPISGGVPHCFPQFGPG
PMQQHGFARNLDWGVSATSADPNPDDKDPAVEVVLTESEYTLKMWPYKFKAVYSVSLHGE
QLNCQLRVINTDDKPFDFTAALHTYIEVLAIEKAKVTGLKGLTYLCKAKDPKNPETKTED
RDEITFTGYTDSVYLNSPSHVELEVGTGAAVALDSSGWEDTVVWNPFTTMKDCYQSFCCV
ENAKFGKPAVVAPGESWSATVTMSVVDVTQ
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggcattcagcagtatgagatctaccatgcgttgtggagcgagaccctgccttcgcacg
ccggcgaaggccgcccggcgtaccacaaccattgtggccagctccgtttcggagctcaac
acgaagtacggcattccgggcagtgtggagtttaaggagggcaagagcggctcgccagta
gtggtgctgaagcacgcctgtggttccactgcggagatgtaccttttcggagcgtgcgtc
acttcttggaagcagcccagcggtgatgagattctgtacgtgcggccagacgccgtcttc
gacaagtccaagcccatctcgggcggggtcccacactgctttccgcagttcggtcccggg
cccatgcagcagcacggcttcgcccgcaacctggactggggcgtgtctgccacctcagca
gaccccaaccctgacgacaaggaccccgctgttgaggttgtcctgaccgagtcggaatac
acgctcaagatgtggccgtacaagttcaaggcggtgtactccgtgtcgctgcacggggag
cagcttaactgccagctgcgggtcatcaacacggacgacaagccgttcgacttcaccgca
gcgctgcacacgtacattgaggtgttggctattgagaaggccaaggtgacgggtctcaaa
ggcctgacctacctgtgcaaggccaaggaccccaagaacccggagactaagactgaggac
cgcgacgagatcaccttcacgggctacacagactcggtgtacctcaactccccctcgcat
gtggagctggaggtgggcactggggctgctgtggcgctggattcctcgggctgggaggac
accgttgtgtggaaccccttcaccaccatgaaggattgctaccagagcttctgctgtgtg
gagaatgccaagttcggcaagcccgctgtggtagcccccggggagagctggtcggcaacc
gtcaccatgtctgttgttgatgtcactcagtaa

DBGET integrated database retrieval system