KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_109762Help
Entry
VOLCADRAFT_109762 CDS       T01330                                 

Gene name
gpx1
Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:vcn00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    VOLCADRAFT_109762 (gpx1)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    VOLCADRAFT_109762 (gpx1)
Enzymes [BR:vcn01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     VOLCADRAFT_109762 (gpx1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 202 aa AA seqDB search
MMLQSRIHARPATRIAARPARHHALKTQALFGFGGAKTAEPSTSEFYSFTVKDIDGKSFP
LSTLKGKAVLVVNLASQCGFTPQYNELQAIYDKFGKQGFTVLGFPCNQFGAQEPGSNQSI
KAFAKSQYGVTFPLMSKVDVNGPGAEPLFNWLKTQKGGVMGNDIKWNFSKFLVDKEGVVV
GRYASTATPGSLEGDIRKALGA
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgatgctgcaatcccgtatccatgctcgcccggcgacacgtatcgcggcgcgcccggca
cgccaccatgctttgaagacccaagcactgtttggctttggtggcgctaaaactgcagag
ccgtcgacaagcgaattttacagcttcaccgttaaggacatcgatggcaagagcttcccg
ctatcgaccttgaaaggcaaggctgttttagtcgtcaacctcgcttcgcagtgcggcttc
acgccccaatacaacgagctgcaggccatctatgataagtttggcaagcagggctttacc
gttctgggcttcccctgcaaccagttcggcgcacaggagcccggctccaaccagtcaatc
aaggccttcgccaaatcccagtacggagtgaccttcccgctgatgtccaaggtggacgtg
aatggccctggagctgagcctctgttcaactggctcaagacgcagaagggcggtgttatg
ggtaatgacatcaagtggaacttcagcaaattcctggtggacaaggagggtgttgtggtg
ggcaggtatgcgtccacggccactccgggttccttggagggcgatatccgcaaggccctg
ggggcatga

DBGET integrated database retrieval system