KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_109912Help
Entry
VOLCADRAFT_109912 CDS       T01330                                 

Definition
hypothetical protein
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vcn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    VOLCADRAFT_109912
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VOLCADRAFT_109912
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VOLCADRAFT_109912
Enzymes [BR:vcn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     VOLCADRAFT_109912
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 450 aa AA seqDB search
MNLHSPRTDAKGRATGRPQTRSKIPRSVRLISRRSTVIVSAVAAPEKPVTEYQRPDATGR
YGIFGGKYVPETLIPALEQLEVDYKAALADPSYKAEMEAILKDYVGRETPLYHAVRLSEH
FATADGGKAEIYLKREDLNHTGAHKINNSLGQALLCKRLNKKRIIAETGAGQHGVATATI
CARLGLKCIVYMGAKDMERQALNVFRMRLCGAEVRPVYSGTATLKDATSEAIRDWVTNVE
TTHYILGSAAGPHPYPMMVRDFQSVIGRETRAQCLEKWGGKPDIVMACVGGGSNAIGIFH
EFVNDTDIRLIGVEAGGEGVNTNKHAATLTRGSPGVLHGSYSYLLQDEDGQIIDPHSISA
GLDYPGIGPEHSFLKDIGRAEYYAVTDAEALEGFQLLSRLEGIIPALETSHAIAYLAKLV
PTLKSGTRVVINCSGRGDKDVNNAMKYLQL
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgaaccttcattctccgcgcacagatgcgaaaggccgtgccactggccggccgcagact
cgttcaaagattccacgttccgtgcgccttatcagtcgtcgtagcacagtcattgtttct
gccgttgcggcaccagaaaagcctgtgactgagtaccagcgtcctgatgcgaccggtcgc
tatggcatcttcggcggaaagtatgtacctgagactctaatccccgcattggaacaattg
gaggtcgactataaggcagccttggcggatccttcgtataaggcggagatggaggctatc
ctaaaggactacgtcggccgtgagacacccctgtaccatgcagttcgtctgtcggagcac
tttgcgacggcggatggaggcaaggcggagatttacctgaaacgcgaggaccttaaccac
accggagcacacaagattaacaattctcttggacaggcattgctgtgcaagcgcttgaac
aagaagcgcattattgctgagaccggtgcaggccagcacggcgttgcgacggctaccatc
tgcgctcgcctggggctcaagtgtattgtttacatgggcgctaaggacatggagcgccag
gctcttaacgtgtttcggatgcgcctctgcggggccgaggtccggccggtgtacagcggc
acggccacgctgaaggatgctaccagcgaggctatccgtgattgggtcaccaacgtggag
acaacccattacatcctgggctcagcagctggtcctcacccctatcccatgatggtccgt
gatttccaatccgtgattggccgcgagacacgggcgcaatgcctggagaagtggggcggc
aagccagatatcgtgatggcgtgtgtgggcggcggctcgaacgctattggcatcttccac
gagtttgtgaacgacactgacattcgtctcattggcgtcgaggcaggtggcgagggcgtc
aacaccaacaagcacgcagccacactgacccgcgggtctccaggggtcctgcacggcagc
tacagctacctgctacaggatgaagacggtcaaattattgacccacactcgatcagtgct
ggactggactaccctggtattggaccagagcattcgttcctaaaggacattggccgcgct
gagtactacgccgtcactgacgcagaagctctcgagggcttccagctccttagcaggttg
gaaggcatcatcccggctctggagactagccacgcgattgcgtacctggctaagctggtg
cccacgcttaagagcggcacacgcgtagtgatcaactgctcagggcgcggcgacaaggac
gtcaacaacgccatgaagtatctgcagctttga

DBGET integrated database retrieval system