KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_116708Help
Entry
VOLCADRAFT_116708 CDS       T01330                                 

Definition
(RefSeq) hypothetical protein
  KO
K11252  histone H2B
Organism
vcn  Volvox carteri f. nagariensis
Brite
Chromosome and associated proteins [BR:vcn03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    VOLCADRAFT_116708
Exosome [BR:vcn04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   VOLCADRAFT_116708
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like RP-C Red1
Motif
Other DBs
NCBI-GeneID: 9625118
NCBI-ProteinID: XP_002948133
JGI: 116708
UniProt: D8TP10
Position
Unknown
AA seq 154 aa AA seqDB search
MAKKDEKTASQPADAAEPKADAKPKAAKVKKEKKAPAKKTAKEPVAGGEEGDKKAKKKAK
VAKSETYKLYIYKVLKQVHPDTGISSKAMSIMNSFINDIFEKVATESSRLSRYNKKPTVT
SREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSA
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggccaagaaggacgagaagaccgcttcgcaaccggctgatgctgctgagcccaaggcc
gatgccaagcctaaggcggcaaaggtgaagaaggagaagaaggcgcctgcgaagaagacc
gcgaaggagccggttgctggtggcgaggagggcgacaagaaggctaagaagaaggccaag
gtcgccaagagcgaaacctacaagctgtacatctacaaggtgctgaagcaggttcatcct
gacaccggtatcagctccaaggccatgtctattatgaacagcttcatcaacgacatcttc
gagaaagtcgccaccgagtcatccagattgagccggtacaacaagaagcccaccgtgacg
tcccgcgaaattcagacggcagtccgcttggtactgcctggcgagctggccaagcacgcg
gtttcggagggtaccaaggctgtcaccaagttcacttccgcctga

DBGET integrated database retrieval system