KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_116708Help
Entry
VOLCADRAFT_116708 CDS       T01330                                 

Definition
hypothetical protein
Orthology
K11252  
histone H2B
Organism
vcn  Volvox carteri f. nagariensis
Brite
Exosome [BR:vcn04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   VOLCADRAFT_116708
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 154 aa AA seqDB search
MAKKDEKTASQPADAAEPKADAKPKAAKVKKEKKAPAKKTAKEPVAGGEEGDKKAKKKAK
VAKSETYKLYIYKVLKQVHPDTGISSKAMSIMNSFINDIFEKVATESSRLSRYNKKPTVT
SREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSA
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggccaagaaggacgagaagaccgcttcgcaaccggctgatgctgctgagcccaaggcc
gatgccaagcctaaggcggcaaaggtgaagaaggagaagaaggcgcctgcgaagaagacc
gcgaaggagccggttgctggtggcgaggagggcgacaagaaggctaagaagaaggccaag
gtcgccaagagcgaaacctacaagctgtacatctacaaggtgctgaagcaggttcatcct
gacaccggtatcagctccaaggccatgtctattatgaacagcttcatcaacgacatcttc
gagaaagtcgccaccgagtcatccagattgagccggtacaacaagaagcccaccgtgacg
tcccgcgaaattcagacggcagtccgcttggtactgcctggcgagctggccaagcacgcg
gtttcggagggtaccaaggctgtcaccaagttcacttccgcctga

DBGET integrated database retrieval system