KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_117126Help
Entry
VOLCADRAFT_117126 CDS       T01330                                 

Definition
hypothetical protein
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
vcn  Volvox carteri f. nagariensis
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:vcn03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 1476 aa AA seqDB search
MDYSALLELLLNLEDASSVDSDEVLLYLQQYKDGFLHLLDLKGPSTESRRQVQQRKVTTA
KYGVQELDPVPDVQQALLLSDELRLDEVLCVEYLTSALEERGVFGAEYAAGLYLEERQAI
ASYVSELLGEKDPPGKQILVARLVTILRDTSLEPRPDSALPVVRDEAGNPVARTLLLQRE
RREAARCLLYCCARDPHVAPAVAVELLELLSGLLSRLGGTGSGDLFLVEECQLVLLACCS
VLLPHEGRNFQQGALQELAQSTRSKVEAVGQAGYSASLRLCWGLLAICSQAGPQDGVVGV
FQHPHFKLDEQTHHHVVAGVIHHVVQTLLRTDGERTSNAFYLQLLHRSEAAIRPTTHGGH
AQLTYVPFPAEAPESRSDHVGSLLGVLADCFEAFPELYLANLADQEAGQRPVKEFLDRSI
NNNIMRTSPEASVRVPFLQLMAALATSERGVHLVLRQMDAMTQVPALEVLTLRKLFHTVL
SYCLRFFATMSEIQRQQQMQMQGGMGAALQGSSLAQYESIMNPYEADILVAFLKLLKRVL
AFGRPAEVLAFWSSTSAELAPSLNGYPLQEPLFQLMCYPVQNNVKAALDEVLGALAAAMP
DMAARLLARLLQCTIVRPASAVLPTVPRLDIVQQLNEIEARREEYPETLALIRLLNALLG
PLLAQGSSQQPGGGIGCGGLPDGGADVTNFTTFVQQHVLGHLWSRGYRVARQKWEVAAAA
FTHLEHVLDLATCGSLPPPQPASEAVANPKCPPGYLIMHDLLGGGPAYAALLHILSPGYT
SLTALQSQTDEVGPREAAVLAALRVINAALRLDLGFVENLSRLNLLNRYQPLHLKLLSGG
VRQLAILLQYVCYPDNADIQVEAIRLTIELSSRLPNLVEVLSDAGAGADGAVVAGALPFV
PASELGGTVGAAATAAALAATAVDLSDVLGSLRRGFAQAMAQGAACPNALDNLDSPQERQ
QGPYGLSADPPDPRVALVLRLMLQNAAPSLPVPSVSHLLLGYDMEHAMSGRLDESLLLPR
QEYSCLTIVERILVQHQLRMAIAKPKLYSQCICLLHRMASAPVGGVPLLEYLSPQNNSLI
PSLRGLLNMELPGTRGGPDGSELRPQELSAALHSRSWYMRITGLLLLRLKHDDNSRQLLG
ELLAAPGEPAITAEPSGLGGPASASAASMAAAAAGGGSVAGTSTLLDTMRVASSLAFPEP
QLSDLSQEQRRMLQDLSAGEAGLEQLLTNPSLMQGAGVAMTSDTGDIIFNISALFALLRQ
RLDAFAARAGGARHNAYVLLAGAQAATVEAWQQLVQVVYTRQYELLNTLLRGSAAEALYD
TLTASLETVRALMSRMDGAAERAAGPLCSAARVLLSKLQEQAILHVSLGQAADPLASVRL
YAATLQYLQLSHGSKLATSCAPTVLAALLQGWGASAEAVAVAVIDQSEELIERANAAVVS
AHGAALVEALAADALSGSAPPLGQAVALHLLRALLA
NT seq 4428 nt NT seq  +upstreamnt  +downstreamnt
atggactactcggcactcttggaactcttgctgaacttggaagacgcgagctctgtggac
agcgatgaggtccttttgtacctgcagcagtataaagatggatttctccatcttttggac
ctcaagggaccgtcaacggagtcgcgtaggcaagtgcagcagcggaaggtcacgacagcg
aagtacggcgtgcaggagcttgacccagttccggatgtgcaacaggcattgctccttagc
gacgagctgcggctcgacgaagtgctgtgcgtcgaatatctcacatcggctcttgaggag
cgcggtgtctttggcgccgagtacgcggcaggtctgtacttggaggagcggcaggccatc
gcctcgtatgtgagcgagctgctgggcgagaaggacccccccggcaagcagatcttggtg
gcccgcttggttaccatccttagggacacttccttggagccccgcccagactcggcgctg
cccgtggtccgtgatgaggccggcaacccggtggcgcgcaccctgctgctgcagcgggag
cgccgcgaggcggcccgctgcctgctctactgctgcgctcgggatccccacgtggcgccc
gcagtagcggtggagcttctggagctgttatcggggttgctcagccggctgggtggaaca
ggctctggggaccttttcctggtggaggaatgtcagctggtgctgctggcctgctgtagc
gtgctgttgccccacgaggggagaaacttccagcagggggcactgcaggagctggcgcag
agcacgaggtccaaggtggaggcggtcggccaggcgggatacagcgcaagtctgcggctg
tgctggggcctgttagccatctgctctcaggcggggccccaggacggtgtggtgggggtg
ttccagcacccgcacttcaagttggacgagcagacgcaccaccacgtggtcgctggtgtc
atacatcacgtggtgcagacgctgctgcggacggacggggagcggacttcaaacgcattc
tatctgcagcttctgcaccgctccgaggccgccatccgacccaccacacacggcggccac
gcgcagctgacctacgtgcccttcccggccgaggcgcccgagtcccgctctgaccacgtg
ggcagcctgttgggggtgctggcggactgctttgaggcctttcctgagctttacctggcc
aatctggcggaccaggaggcagggcagcggcccgtcaaggagttcttggaccggtccatc
aacaacaacatcatgaggacgtcgccggaggcaagtgtccgcgtgccgttcctgcagctc
atggcggcgttggccaccagcgagcggggtgtgcatctggtcctcaggcagatggacgcc
atgacgcaggtgcctgccctggaggtcctgacactgcgcaagctgtttcacacggtgctg
agctactgcctgcgcttctttgcaacaatgtcggagatccagcggcagcagcaaatgcaa
atgcagggcggcatgggcgcggcgctgcagggatcttccttggcgcagtatgagtccatc
atgaacccgtacgaggccgacatcctggtggccttcctcaagctgctcaagcgcgtgctg
gcgttcggtcggccagcagaggtccttgccttctggtcctctacctctgcggagctggcg
ccctcgttgaacggctacccgctgcaggaacctcttttccagctcatgtgctaccccgtc
caaaacaatgtcaaggccgccttggatgaggtgctcggtgcgctggccgctgccatgccc
gacatggccgccaggttgttggcgcgactgctgcagtgcaccattgtgcggccagccagc
gcagtgctgcccaccgtgccgcgactggacattgtgcagcagctgaacgagattgaagct
cgacgggaggagtaccccgagacgcttgcgcttatccgcctgctcaacgcgctgctgggg
ccgcttctggctcagggcagctcgcagcagccaggaggcggcataggctgtggcggcctg
ccggatggaggggccgacgtgaccaacttcaccacgtttgtgcagcagcacgtgctgggc
cacctgtggagccgcggctaccgcgttgctcggcagaagtgggaagtggccgctgccgcc
ttcacgcacttggaacatgttcttgacctggcgacctgtggatcgctgccgccgccgcag
ccagccagtgaggccgtggctaaccccaagtgccccccgggctacctgatcatgcacgac
ctgctgggtggtggccccgcctatgcggcgctgctgcacatcctgtcccccggctacacc
tccttgacggcgctgcaaagccagacagacgaggtggggcctcgcgaggcggcagtactg
gcggccctcagggtcattaacgcggcgttgcggctggacctgggctttgtggagaacctg
tcccgacttaacctgctcaacaggtatcagccgctgcacctcaagctgctgtctggtgga
gtacggcagctggccattctgctgcaatatgtttgctatccggacaatgcggacatccag
gtggaggccattcgcttgaccattgagctaagcagtcgactgcccaacctggtggaggtg
ctatcggacgcgggtgcaggggctgacggggcggtggtggcgggggcgttgcccttcgtg
cccgcctcggagttgggaggcacggtgggggccgcggcgacggcagctgcgctggcggcc
acggcagtggatctttccgacgtgcttggatctctgcgtcgcggttttgcgcaggccatg
gcccagggcgccgcctgccctaacgcgctggacaacttggactcgcctcaagagcgtcaa
cagggcccgtacggcctctccgccgacccgcccgacccgcgtgtggcgctggtgctgcgg
ttgatgctgcagaacgcggcgccgtcgctgccggtcccgtccgtctcgcacttgctgctg
ggatacgacatggagcacgcaatgagcgggcggctggatgagagcctgctcctgccgcga
caggagtacagctgcctcaccattgtggaacggatactggtgcagcaccagctgagaatg
gctattgccaagcccaagctgtatagccagtgcatctgcctcctgcaccgtatggcctcg
gcacccgtgggcggcgtgccgctgctcgagtacctcagcccccagaacaactcgcttatt
cccagcctacgcggcctgctcaacatggagctgcctggtacccgcggcggcccggacggc
tccgagctccgaccccaggagttatccgcagcgctgcacagccgatcctggtacatgcgc
attacgggcctgttgttgctccggttgaagcacgacgataactcccgtcaattgctgggg
gagctgctggcggccccgggtgagcccgcgatcactgcggagccgtcagggctgggcgga
cccgcctccgcctccgctgcctcaatggcggcagcggctgcgggcggcggttccgtggcc
ggcaccagcacgctgctagacacgatgcgtgtggcttcttcgctggcgttcccggagccg
cagctttcagacctgagccaggagcagcgccggatgctgcaggacctgagtgcaggcgag
gcggggctggagcagctcctaaccaacccgtcgctgatgcagggggcgggcgtggccatg
acctcagacacgggcgacatcatcttcaacatttccgcgctgtttgcactgctgcgccag
cggctggacgcctttgcggcgcgcgcggggggcgcacgccacaacgcctatgtgctgctg
gcgggtgcgcaggcggccacggtagaagcgtggcagcagctggtccaggtggtttacacg
cgccagtacgagctgctgaacacgctattgcggggttctgcggcagaggcgctttatgac
acgttgacggcgtcactggagacagtccgggctctcatgtcgcgtatggacggggcggcg
gaaagggcggcggggccactgtgctctgccgcccgggtgttactgtccaagctgcaggaa
caagccatcctccacgttagcctgggccaggccgccgacccgctggcctccgtgcggctg
tacgccgccacacttcagtacctgcagctcagccacgggtctaagctggctaccagctgt
gcgcccacggtgttggcggcgctgctccagggatggggcgcctcggcagaggcggtggcg
gtggcggtgattgaccagtcagaggagctgatcgagcgggccaacgcagctgtcgtctca
gcccacggtgctgcactcgtggaggcgctggctgcggatgcgctcagcggcagcgcaccg
ccgctgggccaggccgtggctctgcacctgttgagagcgctgctcgca

DBGET integrated database retrieval system