KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_120178Help
Entry
VOLCADRAFT_120178 CDS       T01330                                 

Definition
histone acetyltransferase
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
vcn  Volvox carteri f. nagariensis
Brite
Enzymes [BR:vcn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     VOLCADRAFT_120178
Transcription machinery [BR:vcn03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     VOLCADRAFT_120178
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 403 aa AA seqDB search
MFVTLPVGQGNVSIGQEDSYRDTSGSIPQPQQVQRTAENLISERAGPGPLSARDRERIAP
GAYSQREEALVKREQDGDIAFRYVLNNDDPQNLIFLVGLKNIFSKQLPNMPKEYIVRLVF
DRRHRSVALLKRNGTVIGGITYRAFHAQAFGEIAFCAVTSHEQVKGYGTRLMNQTKEFAR
TMDKLTHFLTYADNNAVGYFEKQGFTREVTLERERWQGYIKDYDGGTLMECVMHPRISYT
ALPDMIHRQRIALDDRIRELSQSHVQQGAPRYRLVLEDRGPPKDPTPENLRAFLYNLLEH
IQGLEESWPFKEQVAVQDAPDYYDVIKDPIALDVMEARLSSGCFYVTLEIFNADLRRIFE
NCRFYNAPDTIYYKLANKLESLVNQYLTTHLLFEDEGGNPHPE
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgtttgttaccctgccagttggccagggcaacgtcagtattgggcaagaagactcttat
cgcgacacttcggggagcattccacagccacaacaagtacaacggactgcggaaaacctc
atctcagaacgtgcggggcctggtccattgtcggcacgcgatcgggagcgtatagcgcca
ggtgcatactcccagcgcgaggaggctctcgtaaagcgcgagcaggacggggatatagcc
tttagatacgtcctcaacaacgatgacccgcaaaacctcatattcctggtcggcctgaag
aacatcttctctaaacagctgccaaacatgcccaaggagtacatcgtccggctggtgttt
gaccgccggcatcgttccgtggcgttgctgaagcgcaacgggacagtcatcggtggcatc
acctaccgcgccttccacgcgcaggcatttggcgaaatcgccttttgtgccgtgacatcc
catgagcaggtcaagggctacggcacgcggctcatgaaccagacgaaagaattcgcgagg
acgatggacaagctgacccacttcctcacctacgccgacaataacgcggtgggctacttt
gagaagcagggcttcacgcgcgaggtcaccttggaacgcgagcgatggcaagggtacatc
aaggactacgacggcggcacgctaatggaatgcgtgatgcacccgcgtatttcctacacg
gccctaccggacatgattcacaggcagcgcatcgcgctggacgaccggattcgcgagctc
tcccaatcgcatgtgcagcagggcgccccacgttaccgactagtgctcgaggaccgaggc
ccaccgaaggacccgacgccggagaacctgcgggcgtttctgtacaacctgttggagcac
attcaggggttggaggagtcttggccgttcaaggagcaagtggcggttcaggacgcgcca
gactactacgacgtgatcaaggaccctatcgcgctcgacgtgatggaggctcgtctctcc
tccggttgcttctacgtcacgttggagatattcaacgctgacctgcgccgcatctttgag
aactgccgcttctacaatgcgcctgacaccatttactacaagctcgccaataagttggag
tccctcgtcaaccagtatctgaccacgcacttgttgtttgaggacgagggaggcaacccg
catccggaatag

DBGET integrated database retrieval system