KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_120412Help
Entry
VOLCADRAFT_120412 CDS       T01330                                 

Gene name
eif3X
Definition
eukaryotic translation initiation factor 3-like protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
vcn  Volvox carteri f. nagariensis
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:vcn00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    VOLCADRAFT_120412 (eif3X)
Translation factors [BR:vcn03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    VOLCADRAFT_120412 (eif3X)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 235 aa AA seqDB search
MADDLDDWETADIESDLSKPVSVAAKPAPAFETKGEAILAMINGPVMSQFEDEDKNFTAP
VAHSVPAPQPKKKEEKKYREERVVIDTPLDDPIAEKLRQQKLVEQADFDAARELFGDAST
LKPLESFLPKTLKEFEEFAAEIVARHVVLHRESKHYKAFVKALVKAAVEPLGPEEVKDVE
TSLAGVRSDKAKKKKEDEEKKKGVKKTLNMGKQGLSAGLDDYVYEDNGDEDEDFM
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggctgacgatctagatgattgggagacggctgatattgagtcggatttgtcaaagcca
gtgtcagtggctgctaagccggcgccggcctttgaaaccaagggcgaggccattttggcg
atgatcaatggacctgtcatgtcacaatttgaagacgaggataaaaactttacagcgccc
gtggcgcacagcgtcccagcgccacagccaaagaagaaggaggaaaagaagtaccgcgag
gagcgtgtggtgattgatacccctcttgacgatccaattgcggagaagcttcggcaacaa
aagcttgtggagcaggctgactttgacgctgctcgcgagctctttggtgacgcgtcaacg
ctaaagcccttggaaagtttcttgccaaagacgctgaaggagtttgaggagtttgctgcc
gagattgtggcgcggcatgtggtcctgcaccgggagtccaaacactacaaggcgttcgtg
aaggctctggtcaaggcggcggtggagcccctagggcccgaggaggtgaaggacgtggag
acatcgttggcaggagtacggtccgacaaggccaagaagaagaaggaagacgaggaaaag
aagaagggcgtgaagaagacgctcaacatggggaagcaggggctctccgcgggcctggac
gactacgtgtacgaggacaacggggacgaggacgaggacttcatgtga

DBGET integrated database retrieval system