KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_120505Help
Entry
VOLCADRAFT_120505 CDS       T01330                                 

Definition
hypothetical protein
Orthology
K11407  
histone deacetylase 6/10 [EC:3.5.1.98]
Organism
vcn  Volvox carteri f. nagariensis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 696 aa AA seqDB search
MTQSKDELTQSDAIEVLGVELQRLSVGADESQAAAALDDDFQGDDECSSSSESSAGLPSE
LHLSDGTRAGPQETLPPSAPTENDASVGLLYDQSMEQHFGPDHYERPSRIIQMYATLQEQ
GLLGRCWRLVPRQATDEELLLGHSEDHIRKVDSMFSELYPSRPDTLADAEYCYADGRMGD
VYVCGGTARAARFAAGCCVQAVQSVLSGEVARALAVVRPPGHHAECERAMGFCFFNNVAV
AALAALQTPGTRRVAVLDWDVHHGNGIQNMLLQRPDALYISIHRDPKRFYPYTSGFLGEA
GEGSGTGFNVNVPWLKKGMGDGDYRAAFSLIVEPLLESYQPDLVIVAAGFDAADGDPLGA
CKVSPEGYGWMTERLLRFAGGKLVLALEGGYNNRVTSWCAAACVRTLLEGRAAPPLPPDK
DRLWPAESHNSLKLVYEFQRQHWPVLRARSWTEAWDAHLKDVSRLLGGNLRSKRSSAAGS
NSAITTTTTTTTTISNNSSGKGSTCGGAALLSPTGAGGGDGAAAAPAAVEAPTARRSGGH
GDSACGGNLVGPPPASQSLQEAFKARKAARDAAAAERAAAVAAAAAAAAALPPQPPSSSV
RVDALMALSANARAPAQTFVALMEDAIAAAPDGYVAGECTTTTTTTTCGVSTADAISDGT
ACSFASSILTHGTGFAAAALNPEGDDTGGAGATGGL
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atgactcagtcaaaggacgaattaacacagtcggacgcgatagaagtcttgggcgttgaa
ctgcagcgcttaagtgtgggggctgacgaatcccaggctgcggctgcgttagatgacgac
tttcaaggcgacgatgaatgctctagctcatcggaaagctcagctggtctccccagcgag
ctgcatctgtccgatggcacccgggctgggccgcaggagacgctgccgccaagtgcgcct
accgaaaatgacgcaagcgttgggcttctctatgaccaatccatggagcagcattttgga
ccggatcattacgagcgaccctcccgcatcattcagatgtatgccactctccaagagcag
ggactgttggggcgctgctggcggctggtgccgcgccaagcgaccgacgaggagctgctg
ctggggcacagcgaggaccacatccgcaaggtggattccatgttttcggagctttaccct
tcacggcccgacacgctggcggatgcggagtattgctacgccgacgggcgcatgggtgac
gtgtatgtctgcgggggaacggcacgagcggcacggttcgcggcgggttgctgtgtgcag
gccgtgcagtcggtgctgtccggggaggtggcccgcgccctggcggtggtgcgtccgccg
ggtcaccacgccgagtgcgagcgggccatgggcttttgtttcttcaacaatgtggcggtg
gcggcgctggcggcgttgcagacccccggtacacggcgtgtagctgtgcttgactgggac
gtgcaccacggcaacggaatccagaacatgctactccagcgcccggatgcgctgtacatc
tccatccaccgcgacccaaagcgcttctacccctacacgtctggtttcctcggggaggcg
ggggagggatccggtaccggcttcaacgtgaacgtgccgtggctcaagaagggcatgggg
gacggggactaccgggctgctttttctcttatcgtggagcccctcctggagtcgtaccag
cccgacctggtgattgtggctgcgggctttgacgccgcggacggggaccctctaggggcg
tgcaaggtctccccggagggctacggctggatgacggagcggctgctgcggttcgctggc
ggcaagctggtgctggctctggaggggggatacaacaacagggtgacctcctggtgcgcc
gccgcctgtgtgcggaccctgctggaggggagggccgcgccgccgctgccgccagacaag
gaccgtctgtggccagccgagtcgcacaacagcctcaaactggtttacgaatttcagcgg
cagcattggcccgtgctgcgggcaaggagctggacggaggcgtgggatgcgcacctgaag
gacgtgagccgcctgttgggaggcaatctgcgatccaagcgatcctcagcggcaggcagc
aacagcgccataaccaccaccaccaccaccaccaccaccataagtaacaacagcagcggc
aaaggcagcacctgcggaggcgctgccttgttatcgccgacgggcgccggcggcggcgat
ggcgccgctgcggcgcctgctgccgtagaggcgcccacggcgcggaggtcaggcggccac
ggtgacagtgcatgtggcgggaacctggtcggcccgccaccggcatcgcaatcactgcag
gaagcatttaaggcgcgcaaggcagctagggatgcggcggcagccgagcgcgcggcggcc
gtggcggcggcggcagcggcggcggcggcgctgccgccgcagccgccgtcgtcgtcagtg
cgagttgatgcactcatggcgttgagtgcgaatgcgagggcgcccgcgcaaacgtttgtt
gctcttatggaggatgctattgccgctgctcctgatgggtacgtggctggcgagtgcacc
accaccaccaccaccactacctgcggtgtcagcacggctgacgccatcagcgacggcacc
gcgtgcagctttgcgtcaagcatactgacccacgggacaggtttcgccgccgccgcactc
aacccggaaggtgacgataccggtggcgccggcgccaccggggggctatag

DBGET integrated database retrieval system