KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_121018Help
Entry
VOLCADRAFT_121018 CDS       T01330                                 

Definition
hypothetical protein
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
vcn  Volvox carteri f. nagariensis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 1408 aa AA seqDB search
MDAERTTENLYWAVVLQQYVDANSPSDPASAAERKRLVDHLQANPCSAQAWAQFLMHEEA
MFYSTSASRTLKNNARLRHLFRCASDLVPLEHGMASEAYIYLMIGHARHIWYRHQDEARD
LFKAIKARQYPHRGALMYYEWALLEHEAGNTTKALSVLEKGLRDRAEPRSMLEGLMARWQ
PTQGVGTTSGSSRGETTTVVQQRKVHFQDVSVAAFAATSLTDGAASFRRTAPSTPGASLK
DPSDSATCSSGGGSSVSKSMTTMLPGDLSLGFSTQHTGCMPTKSQVSYQSHAYEEDITNC
RPGEDNRTPGLLGATSRGGAGGSGNTGTVTLPTGIGSALNLVAGAAAVAALGTGSSTGHN
TTSGSTGYPILRRFGFKSKAVRINVEDSRAVQSEGMSSTLTGVVSPAMPANSAAPILSSC
TNEAATSRQSVGMSQQEPPAEECKIDGIGIVTSHSALSSSQPVASAETQATDDLEEGMTR
KRRAASDAAVSPTRSVLSVVLQEEGLKRRQSPDIVPAAGPSCSAGFPTIRGAAAAYGADG
SPSARLADGHVDGCPDAGRCSFMGPSVPSEHLPVHASGSNTAPPTVLAVETALGHDSLGG
WRTSLPQANLPTPSAVVHQRETSADGYRSSYSTASASQAAGQHLERHSSRNVAIPMRSTG
SQGPSYPDENVVPADTAEAPSGDASPPVMDENQAPLLDAARATKQVQAVTSSAPAPQHQL
QYLDNREPLRPVGYAASRPVPPPQAAAAAPQQQPVPMQPVGNWPERLEQRQIRPIENEMY
VYVRGIRYQKLDLAGKGGSSKVYKVLGLNRGIYALKRVRFQNKDNEVVKGFVEEITLLRQ
LRGKPNIIQLIDSQVFYGQGSTGVGFVYMVLEYGDIDLARLLCMHEEARRRATSANGSAD
EGAASSGLDMDGSNCQEIDANFIRLYWQQMLRAVKCIHDARIVHADLKPANFMLVQGQLK
LIDFGIAKAIQGDTTSINRESQVGTLNYMSPEAIQGGTQNPFGGPPVKVGRPSDVWSLGC
ILYQMIYGRTPFADLTFIPKMNAICNPDYKVPMPDCGEPDAVDCIRRCLDRSPKTRISLQ
ELLDHPFLHPNRRKHSPPKVVERALPPPCGVASGMGALTEEQIKAILQLGVGGGGPTDLD
SIARRVMLQLSGREGAVGAAGTSMVTDSVSQPAAQCGAGRLVEDAPPSYPSAALARPPPP
PPPPPPPPFQAGLSRAPPPQPLPVAKPPAAGGGLLDSAARPAGHQRAVQPVPQPAPRSGS
GPSGMGDIAAMVAAAAAKRALRPPGDMKEDKVKSRAPTRAAALPVDRPPSDRPASGNGFM
PLAGAELQAAILQQRAQLRPVQEQPTRSNSQPQLHGRAGGAVAGEAEGVLEAVLRRGLER
FHFSDTGDTLSNTGDFMEAAMTAKQREG
NT seq 4227 nt NT seq  +upstreamnt  +downstreamnt
atggacgctgaaaggactacggagaacctctattgggctgtggttcttcaacagtacgta
gatgcaaacagcccaagtgatcctgcgtctgctgctgaacggaagaggcttgttgaccat
cttcaagcgaatccgtgctctgcgcaagcatgggcgcaatttctgatgcacgaggaagct
atgttctattcaacatccgcaagccgcaccttgaaaaacaacgccaggttgcgacatctg
ttccggtgcgcatcggacttggtgcccttggaacatgggatggcttcggaagcctatatc
tatttaatgattggacatgcacgacacatttggtaccgccatcaggacgaggcccgggac
ctgttcaaagcaatcaaagctaggcagtatcctcatcgtggcgcgctgatgtactacgag
tgggctctgctggagcacgaggccggcaataccaccaaggccttgtctgtactggagaaa
ggcctccgagatcgtgcagagccccgcagtatgctggaggggctcatggcccgctggcaa
cctacgcaaggggtgggaacaacatcaggcagtagtcgcggagagacgacgacggtggtg
cagcagcggaaggttcatttccaggacgtatcggtggcagcttttgctgcaaccagcctt
acagacggtgcagcatccttcaggcgcactgcaccctcgacgcctggggcgagcctcaag
gaccccagcgattctgcgacctgcagctcggggggcggcagctcagttagtaagtccatg
accacaatgctccccggggacctcagcctcggattttcgacacagcatacaggttgcatg
ccaactaaaagccaagtgtcgtaccaaagccacgcatatgaggaggacatcaccaactgc
agacctggggaagacaacaggactccgggcttgcttggtgccacgtcgcgcggtggggct
ggcggcagcggcaatacgggcacggtcacattgcctacgggaattggctctgccttgaac
ctggtggcaggtgcagccgcagttgcagcgcttggtactggctcttcgaccgggcataac
acgacaagtggcagtacgggctacccgatcttgcgacgcttcggcttcaagagcaaagca
gttcggattaacgtagaagattcgagggccgtgcaatcagagggtatgagctctacactg
actggtgttgtgtcgcctgccatgccggcgaacagcgctgcaccgattctcagcagttgc
acgaatgaggcagccacgagtcgacaatcagtgggcatgagtcagcaggagccgccagcg
gaagaatgcaagatagacggcatcggcattgttacctcacacagcgcattgtcctcttca
caacccgtggcttctgcggagacgcaggctacggacgacttggaagagggaatgacacgg
aagaggcgtgctgcatcagatgctgccgtatctcccacacgttcggtactgtccgtcgtg
ctgcaagaagagggcctgaagcgccggcagtccccggacattgtaccggccgctggcccg
tcctgcagtgcaggattccccacgatacgcggagcagctgctgcatacggtgcggatggc
agcccatcagcacggctggcagacggacatgtcgacgggtgcccggatgccggaaggtgc
agcttcatggggccctcagtgccatctgagcatttacctgtgcatgcttcggggtcaaat
acggcacctcctaccgtgttggcggtcgaaacggctcttgggcatgatagcttgggcggg
tggcggacgtcgctgccccaggcaaacctacctactccctctgcagtggtgcatcaacgg
gagacgtccgcggatggctatcgatccagttactccaccgccagcgctagccaagctgct
gggcaacatctggagcggcatagcagtagaaacgtggctattcctatgcgcagcaccggg
tcccagggtccctcctacccagatgagaacgtggttcctgcggacacggcagaggctccg
tctggagacgcatcgcctcctgtgatggatgagaaccaagctcccttgctcgatgcggcg
agggcgaccaagcaggtgcaagctgtgacctccagcgcgcctgcgccgcagcatcagctc
cagtacctcgataaccgggaaccgctcaggccggttgggtacgcggcttcaaggccggtg
ccgccgccgcaggcagctgctgctgcaccgcagcaacagccagtgcccatgcagccagtg
ggcaattggcctgagcgtcttgagcagcggcagatccggcccatcgagaacgaaatgtat
gtgtacgtgcgtggcattcggtaccagaagctggatctagctggcaaaggcggtagcagc
aaagtttacaaggtgctgggtctcaatcgtggcatatatgcgttgaagcgcgtgcgattt
cagaacaaggacaacgaggtagtcaaaggttttgtcgaagaaataacgcttctgcgccag
ctacgtggcaagccgaacatcattcaactgattgattcgcaggtgttttacggccaaggc
tccactggcgtcggtttcgtgtacatggtcctcgagtatggtgacattgacttggccagg
ctgctctgtatgcatgaggaagcgcgccgccgcgccaccagcgccaacggctctgcagac
gaaggtgccgccagtagcggcttggatatggacgggagcaactgccaagagattgacgcc
aacttcattcgtctgtactggcagcagatgctgcgcgcagtaaagtgcattcatgatgcc
cgtatcgtgcacgcggatctaaagcccgccaacttcatgctggtccaggggcaattgaag
ctcatcgacttcggtatcgccaaggcgattcagggcgacacgacgtctattaatcgggaa
tcgcaggttggtacattgaactacatgtcgccggaggccattcagggcggtacccaaaac
ccttttggcggcccgccggtcaaggttggccggccctccgacgtctggagcctcggttgc
atcctctaccaaatgatctacggtcggacgccgttcgctgacctgacctttataccgaag
atgaacgcaatttgcaacccggattacaaggtgcctatgcccgattgcggcgagcccgac
gcagtggactgcattcgcaggtgtctagaccggagcccaaagacgcgaatttcgcttcag
gagttactggaccatcccttcctgcatcccaatcggcgcaagcactcgccgcccaaggtg
gtggagcgagctctgccgccaccctgcggcgtggcgtcgggaatgggagccttgacggag
gaacagattaaagcaatcctgcagctgggcgttggtggtggaggccccacggacctggac
agcatcgcacggcgcgttatgctgcagctgagtggccgtgagggcgctgtgggggcggct
ggaacgagcatggtgaccgattccgtttcacaaccagcggcacaatgcggcgcgggtcga
ttagttgaggatgcgccgccatcgtatccgagtgcggcactggcgcgcccgccaccaccg
ccaccccctccaccgccgccgccctttcaggcgggtctatcgcgggcgccaccaccacag
ccattgccagtagctaagccaccggcagcgggtggcggcctgctggatagtgcagcacgg
cctgcagggcatcagcgtgcagtgcagcccgtgccacaaccggcaccacggagcggctcc
ggccctagcggcatgggtgacatcgcagccatggtagccgctgcggcagcaaagcgggct
ctaaggccgccaggggacatgaaggaagacaaagttaagtcgagagcgcctacacgcgca
gcagcattgcctgtcgatcggccgcccagcgaccggcccgccagcggcaacggcttcatg
cctctcgccggcgccgagcttcaggcggccatattgcagcagagggcacagctccgtccg
gtgcaggagcagccgacgcgaagcaattcgcagcctcagctgcacggtagggctggcggt
gctgtagcgggtgaggccgagggggtgcttgaggctgtgctacggcggggcctcgagcgc
ttccatttcagcgacaccggcgatacgctttcgaacacaggggacttcatggaagctgcc
atgacggctaagcagagggagggttaa

DBGET integrated database retrieval system