KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_121058Help
Entry
VOLCADRAFT_121058 CDS       T01330                                 

Definition
hypothetical protein
Orthology
K06634  
cyclin H
Organism
vcn  Volvox carteri f. nagariensis
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:vcn00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    VOLCADRAFT_121058
  Replication and repair
   03420 Nucleotide excision repair
    VOLCADRAFT_121058
Transcription machinery [BR:vcn03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     VOLCADRAFT_121058
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 367 aa AA seqDB search
MWRGGLGASMDFATSTHRRRWLYTRSKLEEERRRLQQAVVDGLRRQRAAADPLEPEAGSA
TKRPREDPQPVSLVGELLMLKYSQQIIQEKCREMRMPVKVMSTAIQYHKRFFLRHTSMEF
DPGRVMITAIFMATKVEERYTRAADIAAAFDVSEDLVVKQEVALMEGLNFDLVVHSPYRA
LHGMILVVDEACRAAGGALDALMLSDAPLLYSPAQVAAAALRSGFKAKGVRIPNFIARLA
MKAALRAAEGEEGVGVDGGAGAEAAGAQNDPVTALTSVLDELDRLGSEGARRVEVDEVKE
ANAVARQWRSLLKDTTGGAAAGAGKGGGGGGAVADEAARVAKREAKKAARAAAKAKEAEL
LGMPQRQ
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgtggtgggctcggcgcaagtatggacttcgcaacatccacccaccggcggaga
tggctctacacaagaagcaaattggaggaggagcggaggcggctgcagcaggcggtggtg
gacggactcagacgtcagcgagcagctgcggacccgctggagccggaggcgggcagcgcg
acgaagcgacccagagaggacccacagcccgtgtctctggtgggggagctgctcatgctc
aagtactcccaacaaatcatacaggaaaagtgtcgtgagatgcggatgccggtcaaggtg
atgtccacggccattcagtaccacaagcgcttcttcctgaggcacacatcgatggagttc
gatccagggagggtcatgatcaccgcaatattcatggcgacaaaggtagaggagcgctac
acgcgggctgcggacatcgcagcggcgttcgatgtgagcgaggacctggtggtgaagcag
gaggtggccctaatggagggcctcaacttcgatcttgtcgtacattcgccgtacagagca
cttcacgggatgattctggtggtggatgaggcgtgtagggccgcggggggggccctggat
gccctcatgctcagcgatgcgccgctgttgtacagccctgcgcaagtggcggcggcggcg
ttgcggagtgggttcaaggcgaagggtgtgcggatacccaacttcatcgcccggttggca
atgaaggcggcgttgcgggcggcggagggggaggagggggtgggggtggacggcggggcg
ggagctgaggcggcgggtgcgcagaacgaccccgtcacggcgttgacttccgtactggac
gagctggaccggctgggcagcgagggtgctcggagggtggaggtggatgaggtgaaagaa
gccaatgcagtggctaggcagtggaggagcttgctcaaggacacgacggggggggccgcg
gcgggagcgggcaagggtggtggtggtggtggggcagtcgcggatgaagccgctcgggtc
gccaagcgggaggccaagaaggcagctcgcgccgctgccaaggcgaaggaggcggaactg
ctaggcatgccacagcggcagtag

DBGET integrated database retrieval system