KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_121490Help
Entry
VOLCADRAFT_121490 CDS       T01330                                 

Definition
hypothetical protein
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vcn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    VOLCADRAFT_121490
Enzymes [BR:vcn01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     VOLCADRAFT_121490
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 736 aa AA seqDB search
MVDCQAAATDLITAEAQALKIRAADARGFDPDPASARLSRAYPLAAVVGQDNIKQALLLG
AVDTGLGGIAIAGRRGTAKSIMARGLHALLPPIEVVEGSFCNADPEDPRSWEAGLAGKIG
AGPVKAKLRSAPFVQIPLGVTEDRLVGTVDIEASMKEGRTVFQPGLLAEAHRGILYVDEI
NLLDDGIANLLLSILSDGVNVVEREGISISHPCRPLLIATYNPEEGALREHLLDRIAITL
SADVPSAFDDRVKAIDAAMRFQDKPQEVLDEVSEQTDALRNTVTMARECVKNVIITPKQV
SYLVEEARRGGVQGHRADIFAARVAKACAALEGRERVNKDDLRQAVQLVILPRATILDQP
PQEEQPPPPPPPPPPPPQQQQQTQPAPQGETEERRSSEEGEEEEEGSEHEEKESQAQEEQ
EEVPLEFMIEAEGVVLDPAVLDFARKQLRSQGRRSGRTKAIIYSEDRGRYVKAMFPKGNK
IKRLAVDATLRAAAPYQKIRRQHYSASGQPPRKVYIDKSDLRAKRLARKAGALVIFVVDA
SGSMALNRMSAAKGACMRLLAESYTSRDQICLVAFFGDKAQVLLPPSRSITLAKHRLETL
PCGGGTPLAHGLYTAVHTGCTALKSRQVGHVMMVLITDGRANVSLAKSNEAPEALKPDAP
KPSVDRLKDEVCDIAKKAAVAGINTLVIDTENKFVSTGFAEEIAKAAQGKYYYLPNASDA
AIAAAASTAMAAAKAL
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atggtcgactgccaggcagctgcaacagatctcatcactgccgaagcccaagctctgaag
atacgcgcagccgacgcaagaggcttcgaccccgatccggcatccgcgcgcctctcccgc
gcctaccccctggcggccgtggtgggccaggacaatatcaagcaggcgctgctactgggt
gccgtggacactgggctgggaggtattgccatagcaggccgccgcggtacggccaagtcc
atcatggctcgcggcctgcacgcgctgctgcctcccattgaggtggtggaaggcagcttc
tgcaacgcggatccggaggatccccgctcatgggaggccggcctggctggaaagatcggc
gcggggcccgtcaaggccaagctgcgatccgctccgttcgtacagatccccctgggtgtc
acggaggaccgcctggtgggcaccgtggacatcgaggcgtccatgaaggagggccgcacc
gtgttccagcctggtcttcttgctgaggcccaccgcggcatcctgtacgtggacgagatc
aacctgctggacgacggcatcgccaatctgctgctgtccattctgtcggatggcgtcaat
gtggtggagcgggagggcatctcgatcagccacccttgccgtcctctcctgattgccacg
tacaaccccgaggagggcgccctccgcgagcacctgttggaccgcatcgccatcaccctg
tcagccgatgtgccatctgccttcgatgaccgagtcaaggcaatcgacgcagccatgcgc
ttccaggacaagccgcaggaggttctagacgaggtttcggagcagacagatgcgctgcgc
aatacggtaaccatggcccgtgagtgcgtcaagaacgtcatcatcacacccaagcaggtg
tcgtaccttgtggaggaggcgcggcgtggcggcgtgcagggccatcgggcggacatcttt
gcggcacgggtggccaaggcctgcgccgcgctagagggccgcgagcgcgtcaacaaggac
gacctgcgccaggcggtgcagctggtcatcctgccccgggccaccatcttggaccagccg
ccgcaggaggagcagccaccgccgccgccgcccccaccgccgccgccgccgcagcagcag
cagcagacgcagcccgccccgcagggcgaaacagaggagcggcgcagcagtgaagaaggg
gaggaggaggaggaggggagcgaacacgaagagaaggagagccaggcgcaggaggagcag
gaagaggtgccactggagtttatgattgaggcggagggcgtcgtactggatccagccgta
ctggattttgcccgcaaacagctacggtcgcaaggccgccgcagcgggcggaccaaggcc
ataatctattccgaggacaggggcaggtacgtcaaggcaatgttccccaagggcaacaaa
attaaacgtcttgcggtggatgccaccctgcgcgccgcggcaccgtaccaaaagatccga
cgacagcactactctgcctccggccagccgcctcggaaagtctacatcgataaatctgac
ctacgggccaagagattggcacgcaaggccggcgccctcgttatcttcgtggtggacgcc
agcggctccatggcgctgaaccgcatgagcgcagccaagggagcgtgcatgagactgctg
gcagagtcgtacacgtcacgtgaccagatctgcctcgtggccttttttggggacaaggcc
caagttctgttgccaccctctcgatctatcaccctggcgaaacaccgtttggagacgctg
ccctgcggcggtggcacacctctggcgcacgggctgtacactgccgtacatactggctgt
acggcacttaaatctcgccaagtaggccatgtgatgatggtcctaatcacggacggccgc
gcgaacgtgagcttggccaagtctaacgaggccccggaggcgctcaaacccgacgcaccc
aagccctccgttgacaggctcaaggacgaggtatgcgacatagccaagaaggccgccgtg
gctgggatcaacacgctggtcattgacacggagaacaagttcgtgagcacgggtttcgcg
gaggagatcgcgaaggcggcgcagggcaagtactactacctgccgaatgcatccgacgcc
gccatcgcggcagcagccagcacagctatggcggcagccaaggcgctgtga

DBGET integrated database retrieval system