KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_121714Help
Entry
VOLCADRAFT_121714 CDS       T01330                                 

Definition
p300/CBP acetyl-transferase
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
vcn  Volvox carteri f. nagariensis
Brite
Enzymes [BR:vcn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     VOLCADRAFT_121714
Transcription factors [BR:vcn03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    VOLCADRAFT_121714
Mitochondrial biogenesis [BR:vcn03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    VOLCADRAFT_121714
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 1372 aa AA seqDB search
MPQVGGMVPSQPMPQLDPSNHYPQLLGASNPAFNPGAAMPQGVMSNGAPVLLRSQRDWNG
NATQQLLGGQPGQQAMNKLTINGLLPGQLATGPAMISQQQAMPNAGFVPNNGTSGTSGLI
PMANGMVPSGAMVPNGGLVPSGGMVPNGAMVPNGGMVPNSGMVPSAGMVPNGGMVPNGGM
VPNSGMVPSGGMVPNSGMVPSGGMVPNGVMVSNSGMVPNGGMVPSGGMVPSGGMVSSGGM
VPSGGMVPNGGMVPLNPGMPGINTAGSPLLNNMANFSGPQAVSNAGMPEEINPKVQEQYV
QKQQRWLLFLRHCAKCRAPGEECQLKTQCKFGKQLWAHILSCQNAQCDYPRCTSSKELLK
HHQKCQASQCPICAPVKDYVKKTRQATQQQQAQQQAQQQAQQQAQQQQQQQQAAAAQQQQ
QQQVQQQQQGAGGPFMPGQPNMMPNGMVPQQQQQQQQVMRLNANSLGGQKRPHEMMNVGG
MGSASLDGVSRMVPVPGGMGMGMGDPLQQPMQQPQPQGPGQQPMVPQQSQPQQPAPKRPK
TEDVLRQNTGTSLLETFDAKQIRVHVDLIRAAAVTQKAQQQPPPMNPEDACKVCLLAKLS
FEPPVIYCSSCGLKIKRGQIYYSTPPEHGNDLKGYFCHQCFTDQKGERILVEGVAIKKTD
LVKRKNDDEIEEGWVQCDHCEGWVHQICGMFNKGRNNNDVHYLCPECLAYGYERGHRQRT
EIRPQAMLEAKDLPTSKLSEWITERLNRELERERIRRAEQQGKAPHEVPAPEPLTVRMIN
SVKKKCEVKPKFHETFAPDGYVSEFEYRQKVLLLFQSLDGEYGRDCPAPNTNVVYLSYLD
SVKYFRPEIPCALGSNVSLRTFVYHQLLIGYIEFTRNMGFEQMYIWACPPMQGDDYILYC
HPSKQKTPRSDRLRMWYIDMLKQAREEGIVVHLSTLWDTYFEGGRDHRMEKCSATYIPYM
EGDYWPGEAENQLATIADHQRGGKGPKKGATSSTGAVVPSRKAGSKGKRYGGGPATTDEQ
LMSRLGEILGGNMREDFIVVHMQQPCTFCRTHIRGPNVVYRYRVPPGATPPKAAAERKFE
GIKLEGGGPSVPSGTVSSLTICEACFRDEENRVLTAQQLRLPAGVQPHDLLVEKLEEMHI
WDRDPDGDIESEFFETRQSFLSLCQGNHYQFDTLRRAKHSSMMVLYHLHNPHSPAFASSC
NVCNAEIEPGMGFRCTVCSDFDMCASCKFNVGHAHPVVPHKRALDETRQRLTEAERRERN
EQLQKTLALLVHACSCHNPACGSNSCRKVKQLFQHAVQCQAKVTGGCQLCKKMWCLLNLH
AKSCTRADCPVPRCKELKELRRRQTNRQEEQRRAAYAAMLRQQMAAQQQRPM
NT seq 4119 nt NT seq  +upstreamnt  +downstreamnt
atgcctcaagttggaggcatggtgccttcgcagcctatgccgcagctcgacccgagtaac
cattacccgcaactcctgggagccagcaacccagcctttaacccaggcgcagcgatgccg
caaggcgttatgagcaatggtgctcctgtccttttgcgttctcagcgggactggaacggg
aacgcaactcagcagctgcttgggggacaacctgggcaacaggcgatgaacaagctgact
attaacggtctcttgccaggccagctcgcgacgggaccagccatgatttcgcaacagcag
gctatgccaaacgcaggcttcgtgccgaacaacggtaccagcgggaccagtggcttgata
cctatggccaatggcatggtgcccagtggcgccatggtaccaaacggcggcttggttccc
agcgggggcatggttcctaacggcgccatggtgccgaacggaggaatggtgcctaacagc
ggcatggtgcccagtgcaggaatggtaccaaacgggggcatggtgccgaacggaggaatg
gtgccgaacagcggcatggtgccaagcgggggaatggtgccgaacagcggcatggtgcca
agcgggggaatggtgccgaacggcgtcatggtatccaacagcggcatggtacccaacggg
ggcatggtgccgagcggcggaatggtgccgagcgggggaatggtatcaagcgggggaatg
gtgccgagcgggggaatggtgcccaacggcggaatggttccattgaaccccggtatgcct
gggatcaacacggctggctcgccgttgctcaacaacatggcgaacttcagtgggccgcag
gctgtatcgaatgccggcatgcccgaggagatcaaccctaaggtgcaggagcagtacgtg
cagaagcagcagcgctggttgctatttctgaggcactgcgcgaagtgccgggcccctggg
gaagagtgccagctaaaaacgcagtgcaagttcggaaagcagctgtgggcccatatccta
tcgtgtcagaacgcgcagtgcgactacccgcggtgtacgagctccaaagagctgctgaag
caccaccaaaagtgccaggcatcgcagtgtccaatttgtgcgcccgtgaaggattacgtg
aagaagacacgacaggcgacgcagcagcagcaagcgcagcagcaggcgcaacagcaagcg
cagcagcaagcgcagcagcagcagcagcaacagcaagcggcagcagctcagcagcaacag
cagcagcaggtgcagcaacagcagcagggagctggcgggccatttatgccggggcagcct
aacatgatgcccaacggtatggtaccgcagcaacagcagcagcaacagcaggtgatgcga
ttaaacgccaacagcctcgggggccagaagcggccacacgaaatgatgaacgtggggggc
atggggtcggccagcctggacggtgtgagcaggatggtgccggttccgggcggcatgggg
atgggcatgggcgaccccttacagcagcccatgcagcagccgcagccgcaggggcctggc
cagcagcccatggtgccacagcagtcgcagccgcagcagccggcacccaagcggcctaag
accgaggatgtgttgcggcagaatacggggacatcgctgctggagaccttcgacgcaaag
cagatccgtgtgcatgtggatttgatacgggcagcggcggtgacgcagaaagcacagcag
cagccgccgcccatgaatccggaggatgcgtgcaaggtctgcttgctggcaaagctttca
ttcgagccgcccgtcatctactgctcgtcatgcggtctcaaaattaagcgtgggcagatc
tactacagcacacctccagagcacgggaacgacttgaaagggtacttctgccaccagtgc
ttcaccgaccagaaaggggagcgcatcttggtggagggcgtagcaataaagaagacggat
ttagtgaaacggaagaatgatgacgaaattgaggagggctgggtgcaatgcgaccactgc
gagggctgggtgcatcagatctgcggcatgttcaacaagggccgcaacaacaacgacgtg
cactacctatgtcccgaatgcctcgcctacggctacgaacgcgggcatcgacagcggaca
gagattcggccccaggccatgcttgaggctaaggatttgccgacgagcaagctgagtgag
tggattacggagcgccttaatcgggagctggagcgtgaacgtatcaggcgggcagagcag
caggggaaggcgccgcacgaggttccagcgcccgagccgctgacggtgcgcatgatcaac
agcgtgaaaaagaagtgcgaggtgaaacccaagttccacgagacctttgccccggacggc
tatgtctccgagttcgagtatcgccagaaggtcttgttgctctttcagagcctagacggg
gagtacggtagagactgtccagcaccgaacacgaacgtggtgtatttatcgtacctggat
tccgtcaagtacttccgtcccgaaatcccttgcgctctcgggtccaacgtgtcgctgcgc
accttcgtctaccaccagctgctcatcggatacatcgagtttacccgcaacatgggcttc
gaacagatgtacatctgggcgtgcccgccgatgcagggcgacgactacatcctgtactgc
cacccaagcaagcaaaagacgccccgttcggaccggctgcgcatgtggtacatcgacatg
ctgaagcaggcgcgcgaggagggcatcgtggtgcacctttcaacactctgggacacatac
ttcgagggcgggcgagaccaccgcatggaaaagtgcagcgccacttatattccttacatg
gaaggggactactggccaggtgaggcggagaatcagctcgcaaccatcgcggaccaccag
cggggcggaaaggggcccaagaagggcgcgacaagctccaccggcgccgtggtgcccagc
cgcaaggcggggtccaagggcaaacgctatggcggcggcccggcgactacggacgagcag
ctaatgtctcgactgggggagatccttgggggcaatatgcgggaggacttcatcgtcgtt
cacatgcagcagccctgcaccttttgccggacgcacatccgggggcccaacgttgtttac
cggtaccgtgtaccgcccggtgcgacgccaccaaaggctgctgcagagcgcaagtttgag
ggcatcaagctggagggtggtggcccatccgtgccgtccgggaccgtctcctcgttgacc
atctgcgaggcttgcttccgtgacgaggaaaaccgggtgctgacggcgcagcaactccgg
ctaccggcgggcgtgcagccgcacgacttgcttgtggagaagctggaggaaatgcacatc
tgggaccgcgatccggacggggacatcgagagcgagttttttgagacgagacagtccttc
ctctcactgtgccaaggcaatcactaccagttcgacacgttgcggcgtgccaagcacagc
agcatgatggtgctgtaccatttgcacaacccgcactcgccggcgtttgcgagcagctgc
aatgtctgcaatgccgagattgagcccggcatgggcttccgctgcaccgtctgctcggac
ttcgatatgtgcgccagttgcaagttcaacgttggccatgcgcacccggtcgtgccgcac
aagcgcgcgctagacgagacccgacagcggcttacggaggcggagcggcgcgagcggaac
gagcagttgcaaaagacgctggcgctgctcgtccatgcttgcagctgccacaaccccgcg
tgtggaagcaacagctgccgcaaggttaaacagctattccagcacgcggtacaatgccag
gccaaggttacgggcggctgccagctgtgcaagaagatgtggtgtctgcttaaccttcac
gctaagagctgtacacgggcggactgtccggtgccacgctgcaaggagctcaaggagctt
cgccggcgacagacaaatcggcaggaggagcaacgccgcgcggcctacgcggccatgctg
cggcagcaaatggcagctcagcagcagcggcctatgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system