KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_30949Help
Entry
VOLCADRAFT_30949  CDS       T01330                                 

Definition
hypothetical protein
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
vcn  Volvox carteri f. nagariensis
Brite
Enzymes [BR:vcn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     VOLCADRAFT_30949
Protein kinases [BR:vcn01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   VOLCADRAFT_30949
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 398 aa AA seqDB search
LVSVYRSCNDSYRYSHNANPRRVLTKPSVGVKNDGYDNENSDLIMHVNDVLVNGQPGAVL
RHYVVSEMLGQGTFGQVVSCWCQERGASVAVKVIKNQPAYYHQARVEIGLLQLLNTRCDP
ADQHHVVRMVDFFLFRKHLCLVFEKLDVNLFELLRRNGFRGLSLSLVQLFLRQLLDALVV
LRDASIIHCDIKPENILLKSPHSGDLKLIDFGSACFENRTVYSYIQSRFYRSPEVVLGCG
YTVAIDVWSLGCVAAELFLGLPLFPGASEHDLLTRIVQTFGMPPQWLLESAKHVDKFFNK
RLVPLVAHHVLTSQAEFEAKNSCKAPAGKRYFSHTSLPDIILVYPFKQSLSSEEVERERR
ARECFIDFLMGVLELDPRKRWTPRQAAAHPFITGEAFS
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
ctggtatccgtctaccgctcctgcaacgactcttaccgttacagccacaacgccaatccg
cggcgtgtgctgacgaagccgtcagtgggcgtcaagaacgacggatacgacaacgaaaac
tcggatctgattatgcacgtgaacgacgtgttggtgaacgggcagcccggggcggtgctg
cggcactacgtggtgagtgagatgctggggcaaggcacttttggccaggtggtgtcgtgc
tggtgtcaggagcgaggcgcctctgtggcggtcaaggtcatcaagaaccagccggcgtac
taccaccaggcgcgagtggagattgggttgctgcagctgctcaacacgcgttgcgatccg
gcagaccagcatcatgtcgtccgtatggtggactttttcctgttccgcaagcacctgtgt
ctggtgtttgagaaactggatgtcaacctgtttgagctgctgaggcggaacggattcagg
ggtctcagtctgagcctggtgcagctcttcctgcggcaattgttggacgcgctggtggtg
ctgagagacgcgagcatcatccactgcgacatcaagcccgaaaacatcctgctcaagagc
ccccacagcggcgacctgaagctgatcgacttcgggtcggcctgctttgagaaccgcacc
gtctacagctatatccagagccgcttctatcgctcccccgaggtggtcctaggctgcggc
tacacggtggccatagacgtgtggagtctgggctgtgtggcggcggagctgttcctgggg
ctgccgctgttcccgggggcctcagaacacgacctgctcacccgcatcgtacagacgttt
ggcatgccgccgcagtggctgctggagagcgcaaaacacgtggacaagtttttcaacaag
cggctggtgccgctcgtggctcaccacgtcctgaccagccaggcggaattcgaggccaag
aacagctgcaaggccccggccggcaagaggtacttctcgcacaccagcctccccgacatc
atcctcgtctacccctttaagcagagcctgagcagtgaggaggtggagcgggagcggcga
gctagggagtgcttcattgacttcctgatgggggttctggagctggaccccaggaagagg
tggacaccccggcaggccgctgcgcaccccttcatcaccggagaggctttcagt

DBGET integrated database retrieval system