KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_31665Help
Entry
VOLCADRAFT_31665  CDS       T01330                                 

Definition
(RefSeq) hypothetical protein
  KO
K05605  3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
vcn00280  Valine, leucine and isoleucine degradation
vcn00410  beta-Alanine metabolism
vcn00640  Propanoate metabolism
vcn01100  Metabolic pathways
vcn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:vcn00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    VOLCADRAFT_31665
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VOLCADRAFT_31665
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VOLCADRAFT_31665
Enzymes [BR:vcn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     VOLCADRAFT_31665
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_2 ECH_1
Motif
Other DBs
NCBI-GeneID: 9625358
NCBI-ProteinID: XP_002945899
JGI: 31665
UniProt: D8TII0
Position
Unknown
AA seq 342 aa AA seqDB search
LLPAHRPRALNSLNLGMVSAWLEFSRRGESPVAAVVVRGAGGKAFCAGGDVKEVVLRARA
GDWSYGTAFFRTEYVNNAAIAQLPVPYIAVIDGITMGGGVGVSYHGHFRVATERTVLAMP
ESGIGLFPDVGASFFLHRLPGHLGRYMGLTGQRLMGAEVKDAGFATHFIPSARLPDLDRG
VLELGPRAADLSLVDALLRSLEPPPSAAAAVAAAAAAAAGTDNNNNNNSSSNSSALLEWK
LPLINVHFGRRTVAEVVAGSPLSHAVTWEMLRRSAAGHMTLQQCLEMEFLLARRFVAGEA
DFLEGVRALLIDKDNKPRWRYGSVKEVPELVVQRLFEPLVDE
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
ttgctgcccgctcacaggccgcgcgcgctcaactccctcaacctgggcatggtgagtgct
tggctggagttcagccggcggggtgagtcgccggtggcggctgtggtagtgcgaggcgca
ggcggcaaggctttttgcgcgggtggtgatgtgaaggaggtggtcttgcgggcacgagcc
ggcgactggtcgtacggtaccgccttctttcgtaccgagtacgtcaacaatgccgccatc
gcgcagctgccagtgccgtacattgccgtaatcgacgggatcaccatgggtggcggcgtg
ggggtgtcgtaccacggccacttccgtgtcgcaaccgagcggacggtcctcgccatgccc
gagtccggtatcgggctgttcccggacgtgggcgcgtcgttcttcctgcatcgcctgccg
ggccacctgggcagatacatggggctgacagggcagcggctcatgggtgccgaggtcaag
gacgccggcttcgccacccacttcattccctccgcccgcctacccgacctggaccgaggc
gtcctggagctgggccctcgagccgctgacctctccctggtggacgcgctgctgcgctcc
ctggagccaccgccgtcagcggcggcggcggtggcggcagcggcagcggcagcggcaggc
accgacaacaacaacaacaacaacagcagcagcaacagcagcgctctattggagtggaag
cttccgctgatcaatgtccactttggccggcgcaccgtggcggaggtggtggcgggctct
ccgctttcccacgcggtgacgtgggagatgctccgccgcagcgctgccggccacatgacc
ctgcaacagtgcctggagatggagttcctgctggcgaggcgcttcgtggccggggaggcg
gacttcctggagggggtgcgggcgctacttatcgacaaagacaacaagcccaggtggcgg
tacggcagcgttaaagaggttccggagctggtcgtacagcggctatttgagccgctggtt
gatgag

DBGET integrated database retrieval system