KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_33453Help
Entry
VOLCADRAFT_33453  CDS       T01330                                 

Gene name
ssa16
Definition
hypothetical protein
Orthology
K08292  
elongation factor 2 kinase [EC:2.7.11.20]
Organism
vcn  Volvox carteri f. nagariensis
Brite
Enzymes [BR:vcn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.20  elongation factor 2 kinase
     VOLCADRAFT_33453 (ssa16)
Protein kinases [BR:vcn01001]
 Serine/threonine protein kinases: Atypical group
  Alpha family [OT]
   VOLCADRAFT_33453 (ssa16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 177 aa AA seqDB search
RSSSLWHRAINLTKMVADPWGSRNLHVLPMERAVRQRYNALAGHWVTDEVLVKMESKPFA
AGAMRECYAAKKLSTFTHNVDWHKAQNMVAKRYKKEGVRKSVYYNDVLVQMDAKMLGEMY
NKTDPPKQVDVMQCAILQFPGRPGTPVYAVEQLIEGDYVKYNSNSGFGDDVLRNTPQ
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
cgtagcagctccctctggcaccgagccatcaacctgaccaagatggtggccgacccttgg
ggcagtcgtaacctccacgtcctgcccatggagcgagcagtacggcagcggtacaacgcc
ttggccgggcactgggtcaccgacgaagtcctcgtcaagatggagtccaaacccttcgct
gctggggcgatgagagagtgctacgcggctaagaagctgagcaccttcacacacaacgtg
gactggcataaggcccaaaacatggtggccaaacgttacaagaaggagggtgtacggaag
tccgtgtactacaatgatgtgctcgtccagatggacgccaagatgcttggggagatgtac
aacaagacggacccacccaagcaggtggatgtgatgcagtgcgccatcttgcagttcccc
ggccgccccgggaccccggtgtacgcggtggagcagctgatagagggggactacgtaaag
tacaacagcaacagcgggtttggcgatgatgtgttgcgcaacacccctcag

DBGET integrated database retrieval system