KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_34733Help
Entry
VOLCADRAFT_34733  CDS       T01330                                 

Definition
(RefSeq) hypothetical protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
vcn00052  Galactose metabolism
vcn00500  Starch and sucrose metabolism
vcn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vcn00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    VOLCADRAFT_34733
   00500 Starch and sucrose metabolism
    VOLCADRAFT_34733
Enzymes [BR:vcn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     VOLCADRAFT_34733
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_68
Motif
Other DBs
NCBI-GeneID: 9624104
NCBI-ProteinID: XP_002948259
JGI: 34733
UniProt: D8TNY6
Position
Unknown
AA seq 139 aa AA seqDB search
INDPNGLMQYRNMVHVFFQYNPYEAVWGPMHWGHVASPDLVHWVHLPIALAPSDPWDSDG
CWSGSALVTTEDGVPRLYYTGSQDGFFYQAQATALPADPADPFLTRWLKPPDLNPLGLDL
PPGGVRAQFRDPIAPWAVP
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atcaacgaccccaacggccttatgcagtaccgcaacatggtccacgtgttcttccaatac
aacccgtacgaggccgtatggggccctatgcactggggccatgtcgcatctcccgatctg
gtccattgggtccaccttcccatcgccctggcgcccagtgacccgtgggacagtgatggc
tgctggtccggcagtgccctcgtgacgacggaggacggcgtgccacgactgtactataca
ggtagccaggacggcttcttctaccaggcccaggcgacggcccttcccgccgacccagcc
gaccccttcctgactcgctggctcaagccccccgacctcaaccccttggggctggacctg
ccccccgggggggtgagggcgcagttccgagaccccatcgcgccgtgggctgttccg

DBGET integrated database retrieval system