KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_40312Help
Entry
VOLCADRAFT_40312  CDS       T01330                                 

Definition
hypothetical protein
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
vcn  Volvox carteri f. nagariensis
Brite
Enzymes [BR:vcn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     VOLCADRAFT_40312
Peptidases [BR:vcn01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   VOLCADRAFT_40312
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 967 aa AA seqDB search
WELRNFLKLTDKQTSETFEIGTYLWCLLCFPRQNMQPWRHVSLFLEYPEAHYTPVNLSPK
ASFKLFIKNHKDSTKDFTKEASHTFTQDQVDWGFSQMLQLTDISVVSGYLREDGAMVVRV
EITIQRDERYLYDSRTETGYVGLKNQGATCYMNSLLQYLYNLPFFRKAVYHMPVPENEEP
SKSLPVALQSLFYRLQYARGPVSTKELTKSFGWNTYDAFMQHDVQELNRVLCEKLEEKMK
NTKVEKTINELFEGHTYSFIECINVSYKSTRKESFMDLQLDVKGCRNIYDSFDKYTEVEV
LNGPNQYKTDDYGMQDARKGILFEDFPPVLQLQLKRFEYDCQRDAMINDRYEFYDELDLD
RDGGKYLAPNADRSVRNLYKLHSVLVHSGGVHGGHYYAFIRPDGKTWLRFDDDRVSREDQ
RQALDAQFGGGDEDLAGPMPYQQQPMPLKYAKFSNAYMLVYVRQSDWPTIMCEVTKDDIA
KHLLDRLEREMSDKEARHRDKMEAHLYCSLKVATDDDFKQQVGDVSHFDLVDHDRLPPER
CHYRMRKQTKFSEFKEEVARRTGIPPERQRYWTWKRRANGTCRPDRPLTESEEASQLVDL
KDIRDLPRDGHGAAGAKKSLMDIRLYLEELPESPEASCGNNVLLFFKYYDPVTETIAYRG
HHVLPMNGTAAQIGEFLIEDEGLNPDTPTLLFEEVKFEPTVMVTQCDFRQTLRELGLNHG
DVIIYQRKLSKEEIAAENVRYHTADQYLAYIHNRRQVHFKRLEEPQAPPVVTLELLRSTT
YDEMCLALANALGLDDPTKLRITRHNYFSNQPQRSPIKWRTVNSLEQLLTHQQHPTDIIY
YEVLDLPLHEMEQLKTVKVSFHNERGEFVGEQHSLRLRKEASVADLLTELAGRLQQSGTT
AAATMAAAGRSMRLLETIQSKVFKVVDPGERIEHLNDSYWQLRAEFVPEDQLASSLGAGD
FIVHCAH
NT seq 2901 nt NT seq  +upstreamnt  +downstreamnt
tgggagctgcgaaactttcttaaactcactgacaagcaaacgtctgagacgtttgagatt
ggtacatacctatggtgcttgttgtgctttccgaggcaaaatatgcagccgtggaggcat
gtgtcgttgtttttggagtacccggaggcgcactacacgcccgtgaacctcagccctaaa
gcttccttcaagcttttcataaaaaaccacaaggattcaacaaaggatttcaccaaggag
gcgagccacacattcacacaggatcaagtggactggggattcagccagatgctgcagctc
acggacatctccgttgtcagcggctatttgcgcgaggatggcgccatggtggttcgcgtg
gaaattacaatccagcgggatgaacggtatctgtacgacagtcgtactgaaactggctat
gtagggcttaagaaccagggcgcgacgtgctacatgaattcgttgctgcaatacctctac
aacttgccgttttttcgcaaggcggtgtaccacatgccggtgcctgagaacgaggaaccc
agcaaatcgctaccggtggcgctgcagagtcttttttaccggctccaatacgcgcgcggg
cctgtgtctacaaaggagctcaccaagtcttttggctggaacacgtacgatgcgttcatg
cagcacgatgtgcaggagctgaatcgggtgctttgtgagaagcttgaagagaagatgaag
aacacaaaggtcgagaagaccatcaacgagcttttcgagggacacacttacagctttatc
gaatgcatcaatgtgtcgtacaagagcacgcgcaaggagtcgttcatggacctccagctc
gatgtcaagggctgccgcaacatttacgactcttttgacaagtacacggaggtggaggtg
ctcaacgggcccaaccagtataagactgacgactatggtatgcaggacgcacgtaagggc
atccttttcgaggactttccacctgtgctgcagctgcagctgaagcgctttgagtacgac
tgccaacgggatgccatgattaacgaccggtatgagttctatgacgagctggacctagac
cgcgatggcggtaagtacctggcgcccaacgccgaccgctccgtacgcaacctgtacaag
ctgcacagcgtgctggtgcacagcggtggcgtgcacggcgggcactactacgcctttatc
cggccggacggcaagacgtggttgcgcttcgatgacgaccgggttagccgcgaggaccag
cgccaggcgctagacgcacagttcggcggcggcgatgaggacttggccggccccatgcca
taccagcagcagcccatgccgctgaagtatgccaagttttccaacgcctatatgctcgtc
tacgtgcgccaatcggactggcctaccatcatgtgtgaagtgaccaaggacgatatcgcc
aagcacttgctggataggctggagcgtgagatgagcgacaaggaggcgcggcatagggac
aagatggaggcacacttgtactgcagcctcaaggtggcgactgatgatgatttcaagcag
caggtgggtgacgtaagccacttcgatttggtggaccacgaccgtctgccaccggagcgc
tgtcactaccgcatgcgcaagcagacgaagttttcggaatttaaggaggaggtcgccaga
cgaacaggcatccctccggagcggcagcgctactggacctggaagcgccgggcaaacggt
acatgccgccccgacagaccgcttacggagtcggaggaggccagtcagctggtggacctg
aaggacatccgggacctgccacgggatgggcacggggcagcgggagctaagaagtcgctc
atggacatccgcctttacctagaggagctgccggagtcgccggaagcgagctgcggcaat
aacgtgctgcttttcttcaagtattacgacccggttacggagacaattgcgtatcggggt
caccacgtgctacccatgaacggcacggccgctcaaattggcgagtttttgattgaggat
gagggtttgaacccggatacaccaacgctgctgtttgaggaggtcaagttcgagccgacc
gtcatggtgacacagtgcgacttcaggcagacgcttagggaactgggactaaaccacggt
gacgtcatcatctatcagcggaagctgtcgaaggaggagatcgctgcagaaaatgtgcgc
taccatacggccgaccagtatttggcctacattcacaaccgccgacaggtgcacttcaag
cggctagaggagccgcaggcgccgcccgtcgtcacgttggagttgctgcggagtacgacg
tatgacgagatgtgccttgctttggccaacgcgctgggcctggacgatccaaccaaactg
cgaatcacacgtcacaactacttcagcaaccagccgcagcgatcgccaattaaatggcgc
accgtcaactcactggagcagcttctgactcaccagcagcacccaacggatattatatat
tacgaggtgttggatctgccgctgcacgagatggagcagctgaagaccgttaaggtttca
ttccacaatgagcgcggtgagttcgtgggagagcagcactcgttgcggctacggaaggag
gcctctgttgcggacctgctgacggagctggcggggcgcttacagcagtccggaacgacg
gcggcagcgacgatggcggcagcggggcgatcgatgcgattgctagagacaatacaatca
aaagttttcaaggtggtcgatccgggcgagaggattgagcatctcaatgacagttactgg
cagctgcgtgcagagttcgtgccggaagaccagcttgccagcagcctgggcgccggcgac
ttcatcgttcattgtgcgcac

DBGET integrated database retrieval system