KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_42929Help
Entry
VOLCADRAFT_42929  CDS       T01330                                 

Definition
hypothetical protein
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:vcn03410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 325 aa AA seqDB search
MPELPEVEAAKRLMERGCVGKRIERVVAAKDDKVFEDASPDDVRRALEGRRVVAAHRKGK
YLWLELDNPDGLWPLLHFGMTGGIVVQNMGATKYKRIHLASNPDEWPPRFTKLELDLEGG
AKVAFVDVRRFGRVKLLANPSAQEPLSKLGFDVLDELPPLEQFIAAVRKRVARAPGLKIK
ALLLDQEFCSGIGNWVGDEVLYQARIHPEQSAASLGDSALAALRESIRSVVTQAVELEAD
VDRFPPEWLFHHRWNSRKPGSINGHKIEFVTVGSRTSAFVPALQKLQGPRTGAAKKKKTA
SDSEEEEEEEEEEEEEEEEEEEEEE
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagctacctgaggtggaagcagcgaaaaggcttatggagcgaggctgtgtgggc
aaacggattgaaagagttgtggctgcgaaagacgataaggtcttcgaggacgcgtctccg
gatgatgtacggcgtgctctggagggtcggcgggtggttgcagcccaccgcaagggcaag
tacctgtggctggagctggacaaccccgacgggctctggcctctgctacattttggcatg
acgggcggcatcgtggttcagaacatgggtgcgaccaaatacaaacgtattcatttggca
tcaaacccggacgagtggcccccacgcttcaccaagctggagttggatctggagggtggc
gccaaggttgcgttcgtggatgtgaggaggtttggccgcgtgaagctgctcgccaaccct
tcagcacaggagccgctctccaaattgggttttgatgttttggacgagctaccgcctctg
gagcaattcatcgcggcagttcggaagcgggtggcgagagcgccgggtctcaaaattaag
gctttgctcttggaccaggagttctgtagcgggattggcaactgggtgggcgacgaggtt
ctgtaccaagcccgcattcacccggagcagtcagcggcctccctgggggattccgctctg
gcggccctccgcgagtccatccgctcagtggtgacacaggctgtcgagttggaggcagat
gtggaccgcttcccccccgaatggctcttccatcaccggtggaacagcaggaagcccggg
tccatcaacggccacaaaatcgagttcgtgacggtggggtcgcgcacctcggccttcgtg
cccgccctccagaagctccaagggccccgcacgggcgccgctaagaagaagaagacagcc
agcgacagcgaggaggaggaagaggaggaagaggaggaagaggaggaagaggaggaagag
gaggaagaggaggaa

DBGET integrated database retrieval system