KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_42929Help
Entry
VOLCADRAFT_42929  CDS       T01330                                 

Definition
hypothetical protein
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:vcn00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    VOLCADRAFT_42929
Enzymes [BR:vcn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     VOLCADRAFT_42929
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     VOLCADRAFT_42929
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 325 aa AA seqDB search
MPELPEVEAAKRLMERGCVGKRIERVVAAKDDKVFEDASPDDVRRALEGRRVVAAHRKGK
YLWLELDNPDGLWPLLHFGMTGGIVVQNMGATKYKRIHLASNPDEWPPRFTKLELDLEGG
AKVAFVDVRRFGRVKLLANPSAQEPLSKLGFDVLDELPPLEQFIAAVRKRVARAPGLKIK
ALLLDQEFCSGIGNWVGDEVLYQARIHPEQSAASLGDSALAALRESIRSVVTQAVELEAD
VDRFPPEWLFHHRWNSRKPGSINGHKIEFVTVGSRTSAFVPALQKLQGPRTGAAKKKKTA
SDSEEEEEEEEEEEEEEEEEEEEEE
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagctacctgaggtggaagcagcgaaaaggcttatggagcgaggctgtgtgggc
aaacggattgaaagagttgtggctgcgaaagacgataaggtcttcgaggacgcgtctccg
gatgatgtacggcgtgctctggagggtcggcgggtggttgcagcccaccgcaagggcaag
tacctgtggctggagctggacaaccccgacgggctctggcctctgctacattttggcatg
acgggcggcatcgtggttcagaacatgggtgcgaccaaatacaaacgtattcatttggca
tcaaacccggacgagtggcccccacgcttcaccaagctggagttggatctggagggtggc
gccaaggttgcgttcgtggatgtgaggaggtttggccgcgtgaagctgctcgccaaccct
tcagcacaggagccgctctccaaattgggttttgatgttttggacgagctaccgcctctg
gagcaattcatcgcggcagttcggaagcgggtggcgagagcgccgggtctcaaaattaag
gctttgctcttggaccaggagttctgtagcgggattggcaactgggtgggcgacgaggtt
ctgtaccaagcccgcattcacccggagcagtcagcggcctccctgggggattccgctctg
gcggccctccgcgagtccatccgctcagtggtgacacaggctgtcgagttggaggcagat
gtggaccgcttcccccccgaatggctcttccatcaccggtggaacagcaggaagcccggg
tccatcaacggccacaaaatcgagttcgtgacggtggggtcgcgcacctcggccttcgtg
cccgccctccagaagctccaagggccccgcacgggcgccgctaagaagaagaagacagcc
agcgacagcgaggaggaggaagaggaggaagaggaggaagaggaggaagaggaggaagag
gaggaagaggaggaa

DBGET integrated database retrieval system