KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_55168Help
Entry
VOLCADRAFT_55168  CDS       T01330                                 

Gene name
hstH2B-14
Definition
histone H2B
Orthology
K11252  
histone H2B
Organism
vcn  Volvox carteri f. nagariensis
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 161 aa AA seqDB search
MAPKNVKEEKVEEKAEAGAAAKAKAEAKAKAAKPAKKEKKAPAKKAAKEPSAGGEGEGDK
KAKKKAKVAKSETYKLYIYKVLKQVHPDTGISSKAMSIMNSFINDIFEKVATEASKLSRY
NKKPTVTSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atggccccaaagaatgtgaaggaggagaaggtcgaggagaaggccgaggctggcgctgcg
gctaaggctaaggctgaggccaaagccaaggcagcgaaacctgccaagaaggagaagaag
gcgccagcgaagaaggctgcgaaggagccatctgccggtggtgagggcgagggcgataag
aaagctaagaagaaggccaaggtcgcaaagagcgagacctacaagctttatatttacaag
gtgttgaagcaagttcaccctgatactggcatcagctccaaggcgatgagcatcatgaac
agcttcatcaacgacatcttcgagaaggtcgccaccgaggcatctaagctcagtcgctac
aacaagaagcccactgtgacctcgcgcgaaattcagacggcagtgcgcctagtgcttccg
ggcgagctggccaagcatgcggtgtccgagggcaccaaggccgtcaccaagttcacgtcg
tcctaa

DBGET integrated database retrieval system