KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_56082Help
Entry
VOLCADRAFT_56082  CDS       T01330                                 

Definition
hypothetical protein
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
vcn  Volvox carteri f. nagariensis
Brite
Enzymes [BR:vcn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     VOLCADRAFT_56082
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 172 aa AA seqDB search
PYQDAPQALGFGATISAPHMHAACVELLAEQLRPGARVLDVGSGSGYLTLVFAYLANRGP
GARVVGVEHITELVTGSRDAARGIPWAREMMAEDKLRLLQGDGHAGYPEWAPFDAIHVGA
AAPAVPPALLAQLAPGGRLVVPVGPEGGPQQLVVLDKDAQGRVTARKEMGVM
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
ccctatcaggacgcgccgcaggccctgggtttcggagccaccatcagtgcgccccacatg
catgctgcgtgtgtggagctgctggcggaacagctcagacctggggcccgggttcttgat
gtgggctctggttcgggctacctgaccctggtgttcgcctacctggctaatagaggtccc
ggggcaagggtggtgggtgtggagcacatcacagagctggtgaccggctccagggacgca
gcccggggtataccctgggcaagggagatgatggctgaggataagctcaggctgctgcag
ggcgacggccacgcggggtaccccgagtgggcccccttcgacgccatccatgtgggtgca
gctgctcccgcagtgccccccgccctgctggcccagctggccccgggggggaggctggtg
gtgccggtggggcccgaggggggaccgcagcagctcgtagtgctggataaggacgcgcag
gggagggtcactgcgcggaaggaaatgggagtcatgtga

DBGET integrated database retrieval system