KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_56349Help
Entry
VOLCADRAFT_56349  CDS       T01330                                 

Definition
hypothetical protein
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vcn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VOLCADRAFT_56349
Enzymes [BR:vcn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     VOLCADRAFT_56349
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 581 aa AA seqDB search
MLPLRAPQGARCCQKQHEQRPFLKLSSRGFVAHTATYTRQLLSRKRAQVPLASKLEGVAN
PGDRLGPDYDKLIPNYDKGRRAGILLHPTSLPGPYGIGELGDEARRFVDWLADAGMTCWQ
LLPLVPPDPMYYSPYSGTDASCGNPLVISIQELIKEGLLDGSEAPPHVPVGDVDFPSVAA
AKTPLLQRAAQRLLREGRFAALRDQYLAFRSSHPWIEDSALFDVARNLPELNTLAWWEWP
EPLRLRQPAALQEFRTQHANAIDEFIVIQFFFERQWRAVRSYANSRGIKIIGDMPIYVGG
HSADVWANRHLFELNEAGLPAEVSGVPPDAFSATGQLWGSPLYRWPAHRDEGYKWWTARM
ARTLELYDECRIDHFRGFAGYWSVDAKETTAMNGVWRQGPGLELFTAMKAALGSVPILAE
DLGVITRDVVELREAIGAPGMVVLQFAWGGGPGNVHLPHNHYENCFVYPGTHDNETAVGW
FRGSANETDKSYIRSYLRTDGGDIAWDFIRACMAAVPRTCVIMLQDVMRLDNSARMNTPG
TAAGNWRWRVGDSGVWEGLRGAAVDLRRLAHDTNRLPDNRK
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgctcccacttcgcgcgccgcagggcgcacggtgctgccaaaagcaacacgagcaacgc
ccatttcttaaactcagtagcagaggtttcgtcgcccacactgcaacttacacgagacaa
ttgctttcgcgcaagcgcgcccaggtccccctggcgtccaagctggaaggcgtcgcaaac
cccggcgatagactaggtcccgattatgataaacttatcccaaactacgacaagggtcgg
cgggctggcatcttgcttcatcccacgtccttgcccggaccttacggcatcggcgagctg
ggtgatgaagccagacgcttcgttgactggctcgccgacgcggggatgacctgctggcag
ctgctgccactcgtaccgccggacccgatgtactattctccgtactctggtacggacgcc
agttgcggcaacccgctcgtgatctccattcaggagcttatcaaggaaggcctgctcgac
ggctcagaggcgccaccccatgtacccgttggtgacgttgattttccttcagtcgccgca
gccaagacaccattgctgcagcgcgcagcacagcgattgctccgggaaggccgtttcgcg
gctctgcgggatcagtacctagccttccgcagcagccatccctggattgaggactcggcc
ctgttcgatgtggctcgcaaccttccagagctcaacaccctggcgtggtgggagtggccg
gagccgttgcggttgcgccagccggctgcccttcaggagttccggacgcagcacgcaaac
gccattgacgagtttatcgtcatccagttcttctttgagcggcaatggagggcggtccgg
tcctatgccaatagccggggcatcaagatcatcggcgacatgcccatctacgtggggggc
cactccgccgacgtgtgggccaatcggcacctgttcgagctcaatgaggcgggcctacct
gcggaggttagcggagtgccgccggacgccttctccgccaccggtcagctgtggggtagt
ccgctgtaccggtggccagcgcaccgggacgagggctacaagtggtggactgctcgcatg
gcgcgtactctggagctgtacgacgaatgccgtatcgaccatttccggggctttgcgggc
tattggagtgtggacgccaaggagaccaccgccatgaacggcgtgtggcgccagggcccg
ggtctggagctgttcacggctatgaaggcggcgctggggtcggtgcccatccttgccgag
gacctgggggtcatcacacgagatgtggtggagctcagggaggcgatcggtgcaccggga
atggtggtgctccagttcgcgtggggcggcggccccggcaacgtgcacttgccacacaac
cactacgagaactgcttcgtatacccgggtacacacgacaatgagacggcggtgggctgg
tttcggggtagtgctaacgagaccgacaaatcgtacattcggtcgtacttgcggaccgac
ggcggcgacattgcgtgggacttcattcgggcgtgcatggcggccgtcccgcggacgtgt
gtgattatgctgcaggatgtcatgcgattggacaatagcgcgcggatgaacacgccgggc
actgccgccggcaactggcgctggcgcgtgggtgacagcggcgtgtgggagggactccga
ggtgctgccgtggacctccggcgactggcccatgacacgaaccgcctgccggacaacaga
aagtga

DBGET integrated database retrieval system