KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_56863Help
Entry
VOLCADRAFT_56863  CDS       T01330                                 

Definition
(RefSeq) hypothetical protein
  KO
K07204  regulatory associated protein of mTOR
Organism
vcn  Volvox carteri f. nagariensis
Pathway
vcn04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:vcn00001]
 Cellular Processes
  Transport and catabolism
   04136 Autophagy - other eukaryotes
    VOLCADRAFT_56863
Membrane trafficking [BR:vcn04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    VOLCADRAFT_56863
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Raptor_N Peptidase_C14
Motif
Other DBs
NCBI-GeneID: 9620126
NCBI-ProteinID: XP_002947301
JGI: 56863
UniProt: D8TLK8
Position
Unknown
AA seq 428 aa AA seqDB search
LVSKWRQKEKLKTTSVALVLCLNIGVDPPDVIKISPCARLECWVDPMSAQPAKALEHIGK
NLQAQYERWQPRAKYKMHLDPTVEDVKKLCLSCRRNAKNERVLFHYNGHGVPRPTANGEI
WVFNSRYTQYIPLSIYELQSWLGTPSIYVLDCSAAGLIINAIRQLMDQRSNDALRGMAGM
YAGAGAGSSGAPDHLKEIIVLGACGAGEQLPQNPDLPADVFTACLTTPIKVALRWFCSRS
LMRHDGLTKDLTDRIPGKQTDRKTPLGELNWIFTAITDTIAWNVLPRPLFQKLFRSDLLV
ASLFRNFLLAERIMTAAGCTPVSYPRLPPTHQHPMWQAWDLAAEMCLVQLPTLSSDQQAE
FTPSSECWQLSRGESYWRCNSSGVCSCWVGERWGCRCPAMTGIVVRCRKTTGNTGITGCR
YDEPGHWF
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
ctggtgtcgaaatggcgacagaaggagaagctcaaaacgacgagcgtggcgctcgtgcta
tgtctcaatattggtgtcgacccaccggatgtgataaaaatatcgccttgtgcacggctg
gagtgctgggtggaccccatgtctgcacagccggcaaaagccctagaacacattggcaaa
aacctgcaggcacaatacgaacgctggcaaccgcgggctaagtacaagatgcacctggac
cccaccgtggaggacgtgaagaagctgtgcctgagctgcaggagaaacgcgaagaacgaa
cgcgtgctgttccactacaatggacacggcgtgccccggccgacggcgaacggagagatt
tgggttttcaacagccgctacacccagtacataccactgtccatttacgagctgcagagc
tggctggggacgcccagcatttacgtgctggactgctctgcggccggactcatcatcaac
gccatccgccagctcatggaccagcggagcaatgacgcgctcaggggcatggccgggatg
tacgccggggccggggcgggcagctccggggctcctgaccacctcaaggagatcatcgtg
ttgggtgcgtgcggagccggtgagcagctgccgcaaaacccggacctcccggcggacgtg
ttcacggcatgcctcaccacgccaattaaggtggctctgcgctggttctgctctcgcagc
ctgatgcggcatgacgggctgacgaaagacctgaccgacaggattccgggcaagcagacg
gaccggaaaacgcccctgggcgaactgaactggatcttcacagcaatcacggatacgatt
gcgtggaatgtactgccgcggccgctgttccaaaagctgttccgctcggacctgctggta
gcgtccctgttccgcaatttcctgctggcggagcgcatcatgacagcggcgggatgcacg
ccggtgtcgtacccgcggctgccgccgacgcaccagcaccccatgtggcaggcttgggac
ttggcagcggagatgtgcctggtgcagctgccgacactgtcaagcgatcagcaggcagag
tttacaccgtcgagtgagtgttggcagctgtcacggggggagtcgtattggcgctgtaat
agcagcggtgtatgcagctgttgggtcggggagcgctggggttgccgctgtcccgccatg
actgggatagtagtaagatgccgtaaaacgacgggtaatacgggaattacagggtgtcgt
tatgacgaacctggtcattggttttag

DBGET integrated database retrieval system