KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_56863Help
Entry
VOLCADRAFT_56863  CDS       T01330                                 

Definition
hypothetical protein
Orthology
K07204  
regulatory associated protein of mTOR
Organism
vcn  Volvox carteri f. nagariensis
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 428 aa AA seqDB search
LVSKWRQKEKLKTTSVALVLCLNIGVDPPDVIKISPCARLECWVDPMSAQPAKALEHIGK
NLQAQYERWQPRAKYKMHLDPTVEDVKKLCLSCRRNAKNERVLFHYNGHGVPRPTANGEI
WVFNSRYTQYIPLSIYELQSWLGTPSIYVLDCSAAGLIINAIRQLMDQRSNDALRGMAGM
YAGAGAGSSGAPDHLKEIIVLGACGAGEQLPQNPDLPADVFTACLTTPIKVALRWFCSRS
LMRHDGLTKDLTDRIPGKQTDRKTPLGELNWIFTAITDTIAWNVLPRPLFQKLFRSDLLV
ASLFRNFLLAERIMTAAGCTPVSYPRLPPTHQHPMWQAWDLAAEMCLVQLPTLSSDQQAE
FTPSSECWQLSRGESYWRCNSSGVCSCWVGERWGCRCPAMTGIVVRCRKTTGNTGITGCR
YDEPGHWF
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
ctggtgtcgaaatggcgacagaaggagaagctcaaaacgacgagcgtggcgctcgtgcta
tgtctcaatattggtgtcgacccaccggatgtgataaaaatatcgccttgtgcacggctg
gagtgctgggtggaccccatgtctgcacagccggcaaaagccctagaacacattggcaaa
aacctgcaggcacaatacgaacgctggcaaccgcgggctaagtacaagatgcacctggac
cccaccgtggaggacgtgaagaagctgtgcctgagctgcaggagaaacgcgaagaacgaa
cgcgtgctgttccactacaatggacacggcgtgccccggccgacggcgaacggagagatt
tgggttttcaacagccgctacacccagtacataccactgtccatttacgagctgcagagc
tggctggggacgcccagcatttacgtgctggactgctctgcggccggactcatcatcaac
gccatccgccagctcatggaccagcggagcaatgacgcgctcaggggcatggccgggatg
tacgccggggccggggcgggcagctccggggctcctgaccacctcaaggagatcatcgtg
ttgggtgcgtgcggagccggtgagcagctgccgcaaaacccggacctcccggcggacgtg
ttcacggcatgcctcaccacgccaattaaggtggctctgcgctggttctgctctcgcagc
ctgatgcggcatgacgggctgacgaaagacctgaccgacaggattccgggcaagcagacg
gaccggaaaacgcccctgggcgaactgaactggatcttcacagcaatcacggatacgatt
gcgtggaatgtactgccgcggccgctgttccaaaagctgttccgctcggacctgctggta
gcgtccctgttccgcaatttcctgctggcggagcgcatcatgacagcggcgggatgcacg
ccggtgtcgtacccgcggctgccgccgacgcaccagcaccccatgtggcaggcttgggac
ttggcagcggagatgtgcctggtgcagctgccgacactgtcaagcgatcagcaggcagag
tttacaccgtcgagtgagtgttggcagctgtcacggggggagtcgtattggcgctgtaat
agcagcggtgtatgcagctgttgggtcggggagcgctggggttgccgctgtcccgccatg
actgggatagtagtaagatgccgtaaaacgacgggtaatacgggaattacagggtgtcgt
tatgacgaacctggtcattggttttag

DBGET integrated database retrieval system