KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_56996Help
Entry
VOLCADRAFT_56996  CDS       T01330                                 

Gene name
hstH2B-1
Definition
(RefSeq) histone H2B
  KO
K11252  histone H2B
Organism
vcn  Volvox carteri f. nagariensis
Brite
Chromosome [BR:vcn03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    VOLCADRAFT_56996 (hstH2B-1)
Exosome [BR:vcn04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   VOLCADRAFT_56996 (hstH2B-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like Red1
Motif
Other DBs
NCBI-GeneID: 9620513
NCBI-ProteinID: XP_002947412
JGI: 56996
UniProt: D8TM85
Position
Unknown
AA seq 157 aa AA seqDB search
MAPKKEEKPASQAAEAPEVKAEAKPKAVKAPKKKEKKAPAKKVAKEPSAGGEDGDKKSKK
KAKVAKSETYKLYIYKVLKQVHPDTGISSKAMSIMNSFINDIFEKVATEASKLSRYNKKP
TVTSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSA
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atggccccgaagaaggaggagaagcccgcatcccaggccgctgaggctcctgaggttaag
gctgaggctaagcccaaggctgtgaaggctcccaagaagaaggagaagaaggcgccggct
aagaaggtcgccaaggagccttccgctggtggggaggatggcgacaagaagtccaaaaag
aaggccaaggttgccaagagtgagacctacaagctgtacatctataaggtgctgaagcag
gtgcaccctgacaccggcatcagctccaaggcgatgagcatcatgaacagcttcatcaac
gacatatttgagaaggtcgccaccgaggcttcaaagcttagccgttacaacaagaagccg
accgtcacgtctcgcgaaatccagactgccgtgcgccttgtcctgccaggcgagctggcc
aagcacgctgtgtccgagggaaccaaggctgtcaccaagttcacgtccgcttaa

DBGET integrated database retrieval system