KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_57848Help
Entry
VOLCADRAFT_57848  CDS       T01330                                 

Definition
hypothetical protein
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vcn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    VOLCADRAFT_57848
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VOLCADRAFT_57848
Enzymes [BR:vcn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     VOLCADRAFT_57848
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 307 aa AA seqDB search
MGEVTIRRRPPHGLETQPCGPHAFRVGGLPEENKPQNILEEIVWWKAREVEVMRDKQPLA
MLQALAKKMDPPRDFRGAVLAKANETGRPGLIAEVKKASPSKGVIQPDFDPVRIAQAYER
GGAACLSVLTDAKFFQGSFQNLTRIRAAGVQCPLLCKEFIVEAYQVYKARASGADAILLI
AAVLPNADLAYFMKAASNLGMTCLIEVHTEGELARVLQLPGVENHLLGINNRDLGTFKVD
LNTTKRIMDSEWGQQVKDRGIVMVGESGIFTPEDVAFVKQAGCGAILVGESIVKQGDPEA
GVKALLA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaggtgaccatccgccggcgaccaccgcacgggctggagactcagccctgcggt
cctcacgcatttcgcgtgggcggtttacccgaggaaaacaagccacagaacatcctggag
gagatcgtctggtggaaggctcgcgaggtggaggtgatgcgcgacaagcagccgctggcg
atgctgcaagctctggccaagaagatggatcctccgcgggacttccggggggcggttctg
gctaaggccaatgagacaggccgccctggcctcattgcggaggtgaagaaggcctccccc
tctaagggagtcatccagcccgacttcgacccggtgcgcatcgcccaggcctacgagcgg
ggcggggccgcgtgtctgtccgtgctcacggacgcaaagtttttccagggctccttccag
aacctgacccgcattcgtgctgcgggtgttcagtgccccctgctgtgcaaggagttcatt
gtggaggcgtaccaggtgtataaggcccgggctagcggcgcggacgccattctgttgatc
gctgcggtgcttcccaacgcggacctggcctatttcatgaaggccgcgagcaacctgggg
atgacctgtctcatagaggttcacaccgagggcgagctggcccgcgtactgcagctaccc
ggagtcgagaaccacctgctgggcattaacaatagggaccttggcacgttcaaggtggat
ctgaacaccaccaaacggatcatggacagcgagtgggggcagcaggtaaaggatcggggt
atcgtcatggttggggagagcggcatcttcaccccggaggatgtggccttcgtaaaacag
gctggctgtggtgccattttggtgggcgagtccattgtgaagcaaggggacccggaggcg
ggagtcaaggcgctcctggcgtga

DBGET integrated database retrieval system