KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_59916Help
Entry
VOLCADRAFT_59916  CDS       T01330                                 

Definition
(RefSeq) hypothetical protein
  KO
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
vcn  Volvox carteri f. nagariensis
Brite
Enzymes [BR:vcn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     VOLCADRAFT_59916
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 325 aa AA seqDB search
MSLGYADRLKNKRNLGGQLGAKEYHQTFDEIKEGVKSLAKWVADAKRVFVFTGAGISTSC
GIPDFRGPNGIWTLRKKKIPIPTDFTPFEYAKPSFTHMAIAALVAAGKVPYVCSQNVDSL
HLWSGVPRNRLAELHGNCFAERCTQCRSEYARDFQMETVDFKPSGRLCDQPACGAPLVDN
ILDWDTPLPEDELGEAVRHAEEADVALVLGTSLQIQPANEIPTLTRDGGGKMVIVNLQKT
PKDRRANLIIRSRVDLVMALLMKELGMQVPPYIRTERLVVEHELSHSGGGGGGRVLTVRV
RSQHGRHCPLPMVESVQISVTAEPE
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtccttgggatacgccgaccgcctgaagaacaagcgcaacttaggtggccagcttggc
gcgaaggaataccatcaaacctttgatgaaattaaagaaggcgtcaaatctctagcaaaa
tgggttgcggacgccaagcgagtctttgtgttcacgggcgctgggatttcaacctcttgc
ggaatacctgacttccgggggccaaacgggatttggacattgcgcaagaagaagatcccc
attcccaccgacttcaccccgtttgagtacgccaagccaagcttcacgcacatggcaatc
gccgcgctggtcgctgctggcaaagtgccgtacgtttgcagtcaaaacgtcgactccttg
catttatggagtggggtgcccaggaaccggttggcggagttgcacggcaattgctttgcg
gaacggtgcacgcagtgccgttcagagtacgcccgagactttcagatggagacggtcgac
ttcaaacccagtggccggttgtgcgaccaacccgcctgcggggctcccctggtggacaac
atcctggactgggacacgcccctgccggaagatgagctgggcgaggccgtacgacacgcg
gaggaagcggacgtggcgctggtgctgggcacctcactgcagattcagcccgcgaacgag
atcccgaccctgacaagagacggaggcggtaagatggtgatcgtcaacctccagaagacc
cccaaggaccgccgagccaacctcatcattcgcagtcgggtggatctagtgatggcgctg
ctcatgaaggaactgggaatgcaggttcctccgtacatccgtacagagcggcttgtcgtg
gagcacgaactctcccacagtggcggcggtggtggcggccgcgtcctcacggttcgcgta
cggagccagcacggccgccactgtccgttgccgatggtcgagtccgtgcagatctccgtc
acagcggagccagag

DBGET integrated database retrieval system