KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_62803Help
Entry
VOLCADRAFT_62803  CDS       T01330                                 

Gene name
glgb4
Definition
1,4-alpha-glucan branching enzyme II
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vcn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    VOLCADRAFT_62803 (glgb4)
Enzymes [BR:vcn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     VOLCADRAFT_62803 (glgb4)
Exosome [BR:vcn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VOLCADRAFT_62803 (glgb4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 712 aa AA seqDB search
QYRWNVFKNIRSAIDQNEGGFEKFTEGYKYYGFNRGECNGQTGIWYREWAPGAKALALVG
DFNNWTPADSHWAFKNQFGTWELFLPDMPDGTPAIPHRTKVKCRLETADGHWMDKIPAWI
KWATQEWNEILFNGVHWDPPEKGAPGEVAENKAYTFKYPRPPKPRALRIYECHVGMSSQE
PKVNSYLEFRKDVLPRIRALGYNAIQIMAIQEHSYYGSFGYHVTNFFGVSSRCGTPDELK
ALVDEAHRMGLVVLMDIVHSHASKNTNDGINMFDGTDGMYFHGGPRGNHWMWDSRCFNYG
NWETMRFLLSNARWWMDEYKFDGYRFDGVTSMMYHHHGLSYTFTGNYGEYFGMNTDVDAV
VYLMLVNNLLHDMFPSCISIGEDVSGMPSFCRPWHEGGVGFDYRLQMAIADKWIEVMKLH
DDFAWNMGNIVHTLTNRRYAEACVGYAESHDQALVGDKTIAFWLMDKDMYDYMAVPGMGP
QSLIVDRGIALHKMIRLITIALGGESYLNFMGNEFGHPEWIDFPRVDSYDPSTGRFVPGN
GGSLHLCRRRWDLADSDFLKYKFLNAFDRAMCHLDKAFGYVCAPNTYISRKDEGDKLIVF
ERGDLVFVFNFHPTQSFMDYRVGCREAGPYKLVLSSDEEVFGGYRNITKETDATFQTTPG
NYDNRPHSFQVYAPARTCAVYAPAAWADKDADRKPHGIPGLAVKDLGPYFSR
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
cagtaccggtggaacgttttcaagaacatccgcagcgccatcgaccagaacgagggcggc
tttgagaagtttacagagggttataaatactacggcttcaaccgcggggagtgcaacggc
caaaccggtatttggtaccgcgagtgggctccgggagccaaggctctggctctggttggt
gatttcaataactggaccccggctgacagccactgggcctttaagaaccagttcggcacc
tgggagctcttcctgccggatatgccggacggcactcccgccatcccgcacaggaccaag
gtgaagtgtcgtttggagactgctgacggccactggatggacaagatccccgcctggatc
aagtgggccacccaggagtggaacgagatcctctttaacggtgtgcactgggaccccccg
gagaagggcgccccgggcgaggtggcggagaacaaggcatacaccttcaagtacccccgt
ccgcccaagccccgcgctctgcgtatttacgagtgccacgtgggcatgagcagtcaggag
cccaaggtgaacagctacctggagttccggaaggacgtgttgccgcgcatcagggcgctg
ggctacaacgccattcagatcatggccatccaggagcacagctactacggctccttcgga
taccacgtcaccaacttctttggggtcagcagccgttgcggtacacccgatgagctcaag
gcgctggtggatgaggctcaccgcatgggtctcgtggtgctgatggacatcgtgcacagc
cacgcctccaagaacaccaacgacggtatcaacatgttcgacggcaccgacggaatgtac
ttccacggcggcccgcggggcaaccactggatgtgggacagccgctgcttcaactacggc
aactgggagacaatgcgcttcctgctgtccaacgcccgctggtggatggacgaatacaag
tttgacggataccgtttcgacggcgtcacgtccatgatgtaccaccatcacggcctgtcg
tacacgttcaccggcaactacggcgagtacttcggcatgaacacggacgtcgacgcggtg
gtttatctgatgctggtgaacaacctgcttcacgacatgttccccagctgcatcagcatt
ggggaggacgtgtccggcatgccttccttctgccggccatggcacgagggcggtgtgggt
ttcgactaccgcctccagatggccatcgcggacaagtggatcgaggtgatgaagctgcac
gacgacttcgcctggaacatgggcaacatcgtgcacacgctcacgaaccgcaggtacgcg
gaggcgtgtgtgggctacgcggagagtcatgaccaggccctggtgggggataagaccatc
gccttttggctcatggacaaggatatgtacgattacatggccgtacctggcatgggcccc
cagtctcttattgtggaccgcggcattgcactgcacaagatgatccgcctcatcaccatc
gccctgggaggggagtcctacctcaacttcatgggtaacgagttcggccaccccgagtgg
atcgacttcccccgcgtggacagctacgacccctccacgggccgcttcgtgccaggtaat
ggcggctcactgcatctgtgccgtcggcgctgggacctggcggactccgacttccttaag
tacaagttcctgaacgccttcgaccgggccatgtgccacctcgataaggcgttcggctac
gtttgcgcccccaacacttacatcagccgcaaggatgagggcgacaagttgatcgtgttc
gagcggggtgacctcgtgttcgtgttcaacttccatcccacgcagtccttcatggactac
cgggttggctgccgcgaggcggggccgtacaagttggtcctgtccagtgacgaagaggtg
ttcggcggctaccgcaacatcaccaaggagaccgacgccaccttccagacaacgcccggc
aactacgacaaccgcccgcactccttccaggtgtacgcgcctgcccgcacctgcgccgtg
tacgccccggccgcctgggcggataaggacgccgaccgcaagccacacggtataccgggt
ctggccgtcaaagacctgggtccctacttttcgaggtga

DBGET integrated database retrieval system