KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_62867Help
Entry
VOLCADRAFT_62867  CDS       T01330                                 

Definition
hypothetical protein
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vcn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    VOLCADRAFT_62867
Enzymes [BR:vcn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     VOLCADRAFT_62867
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 204 aa AA seqDB search
MAPLQRDRDKLARMEQAVRTLLQGLGEDVDREGLRDTPKRVAKALLDCTQGYHQDTSRSL
FHEPLVHQGGEGIVVVRDIDFASTSEETLLPFHGRCHVAYRPKGGVVLGLSKLARLTKQY
AKRLQTQQRLAASIALALQHSLECHGVASRGGGVMVVCDAAHMCMVARGVENHSGSTTTF
AVRGVFARRPELRRAVLRLFREHR
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggcacccctgcagcgtgaccgcgataagctagcccgtatggagcaagcagttcggaca
ttattacaaggtcttggagaggatgttgatcgggaaggcctgcgtgatactccaaagagg
gttgcgaaggcgctattggactgtacacaagggtatcaccaggacacgtcaaggtcgctt
ttccacgagcctcttgtgcatcaaggcggggagggcatcgttgtagttcgggatattgac
tttgcgtcgaccagcgaggagacgctcctacctttccatggccgctgccatgtggcctat
cgccctaaaggcggcgttgtgttggggctcagtaagctggcgcgcctcacgaagcaatac
gccaaacgactccaaacgcagcagcgacttgcggcgtccatagcgctggcgctgcagcac
agtctggagtgccacggcgttgcctcgcgtggtggtggggtgatggtggtgtgcgatgcc
gcgcacatgtgcatggttgctcgcggagtagagaaccacagcggcagcacaacgacgttt
gcggtacgcggtgtgtttgcgaggcggccggagctgcggcgcgcggtgctgaggctgttt
cgggaacataggtga

DBGET integrated database retrieval system