KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_62995Help
Entry
VOLCADRAFT_62995  CDS       T01330                                 

Definition
(RefSeq) hypothetical protein
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
vcn  Volvox carteri f. nagariensis
Brite
Enzymes [BR:vcn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     VOLCADRAFT_62995
Chromosome and associated proteins [BR:vcn03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     VOLCADRAFT_62995
   HDAC complexes
    Sin3A-HDAC complex
     VOLCADRAFT_62995
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    VOLCADRAFT_62995
  Chromatin remodeling factors
   NuRD complex
    VOLCADRAFT_62995
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 9627584
NCBI-ProteinID: XP_002952849
JGI: 62995
UniProt: D8U2A7
Position
Unknown
AA seq 419 aa AA seqDB search
MARKNKVAYFYDSEFQEFYFGQNHPMKPHRLAMTHHLVLGYGLHKKMDVFRPRKAHPAEL
AQFHSEDYVEFLSKVTPDSAAKYANQLRQYNFNDDCPVFDNMFKFCQLYAGASIEGAVKL
NHGLCDIAINWSGGLHHAKKGEASGFCYVNDLVLAILELLKYHARVLYIDIDVHHGDGVE
EAFYLTDRVMTVSFHKYGDYFFPGTGDLTDTGELNGKYYSLNVPLKDGTNDETFHALFKP
IMRRVMEVFQPGAIVMQCGADSLAHDRLGCFNMSLRGHGEAIRFMKEFGVPLLITGGGGY
TKHNVARCWTYETAILTDTQVPEQLPRSDYHEYFAPDFSLNVSAHKVMDDNNTKADIERI
RREVLEYLRHLQHAPGVQMQEVPPDCRVPRWDESWGGWPDCRRRRSPGRMAGWGRVAGP
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggcccggaaaaacaaagtggcctacttctatgacagcgagttccaagaattctatttt
ggtcagaaccacccgatgaaaccgcaccggctggctatgacacaccatctggtcctagga
tatggtcttcacaagaaaatggacgtatttcgtcctcgcaaggcccacccagctgagctt
gcacaatttcatagcgaagattatgtggaattcctctcgaaagttacaccggacagtgct
gccaagtatgctaatcaactccgtcagtacaacttcaatgatgactgtcccgtcttcgat
aatatgttcaagttctgccaattgtacgcgggggcatcaatcgagggtgccgtcaagctg
aaccacggcttgtgtgatattgcgattaactggtcggggggcctgcatcatgctaagaag
ggtgaggcatctggcttttgttacgtgaacgacctggtgcttgcaatccttgagctcctc
aagtaccacgcaagagttctgtacattgatatcgatgttcaccatggtgatggcgtggag
gaggcgttctacctcacggatcgggtgatgaccgtttcctttcacaagtacggcgactac
ttcttccccggaactggtgatctcacggacacgggcgagctgaacggcaagtactacagc
ctcaacgtgcccttgaaggacggcaccaacgacgagacgttccacgcgctgtttaagccc
atcatgcgccgggtgatggaggtgtttcagccgggggctattgtgatgcagtgcggcgcc
gactcgctcgcgcatgaccggctgggttgcttcaacatgtcgctgcggggccacggcgag
gcgattcgctttatgaaggagtttggtgtgccgcttctcatcacgggtgggggtggctac
accaagcacaatgtggcacgatgctggacatacgagacagccatcctcacagacacgcag
gttccggagcagctcccgcgctccgactaccatgagtattttgcgccagacttctcacta
aacgtctccgcgcataaggtgatggacgacaacaacacgaaggcggacattgagcgcatc
cggcgggaggtgctcgagtacctgcggcacctgcagcacgcgccgggggtccagatgcag
gaggtgccgcctgactgccgggtgccgaggtgggatgaatcctgggggggatggcctgac
tgccggcgtaggaggagccctggcaggatggctgggtggggcagggtggctgggccataa

DBGET integrated database retrieval system